KEGG   Homo sapiens (human): 85397
Entry
85397             CDS       T01001                                 

Gene name
RGS8
Definition
(RefSeq) regulator of G protein signaling 8
  KO
K16449  regulator of G-protein signaling
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    85397 (RGS8)
Motif
Pfam: RGS
Other DBs
NCBI-GeneID: 85397
NCBI-ProteinID: NP_001095920
OMIM: 607189
HGNC: 16810
Ensembl: ENSG00000135824
Vega: OTTHUMG00000035219
Pharos: P57771(Tbio)
UniProt: P57771
Structure
PDB: 
2IHD 2ODE 5DO9

Position
1q25.3
AA seq 180 aa
MAALLMPRRNKGMRTRLGCLSHKSDSCSDFTAILPDKPNRALKRLSTEEATRWADSFDVL
LSHKYGVAAFRAFLKTEFSEENLEFWLACEEFKKTRSTAKLVSKAHRIFEEFVDVQAPRE
VNIDFQTREATRKNLQEPSLTCFDQAQGKVHSLMEKDSYPRFLRSKMYLDLLSQSQRRLS
NT seq 543 nt   +upstreamnt  +downstreamnt
atggcggccttactgatgccacgcaggaacaaagggatgaggactcgactgggatgcctg
tctcacaagtcagactcgtgtagtgatttcacagctattcttccagacaaacccaaccgc
gctctcaagagattatcgacagaagaagctacgaggtgggcagattcctttgatgtgctt
ctctctcataagtatggggtggctgcattccgtgccttcttgaagacggagttcagtgag
gagaacctggaattctggttggcctgtgaggagttcaagaagaccaggtcaactgcaaaa
ctggtctctaaggcccataggatctttgaggagtttgtggatgtgcaggctccacgggag
gtaaacattgacttccagacccgagaagccacgaggaagaacctgcaggagccatccctg
acttgctttgaccaagcccaaggaaaagtacacagcctcatggagaaagactcttacccc
aggttcctgaggtccaaaatgtacttagatctgctgtcccaaagccagaggaggctcagt
tag

DBGET integrated database retrieval system