KEGG   Homo sapiens (human): 8540Help
Entry
8540              CDS       T01001                                 

Gene name
AGPS, ADAP-S, ADAS, ADHAPS, ADPS, ALDHPSY, RCDP3
Definition
(RefSeq) alkylglycerone phosphate synthase
  KO
K00803  alkyldihydroxyacetonephosphate synthase [EC:2.5.1.26]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00565  Ether lipid metabolism
hsa01100  Metabolic pathways
hsa04146  Peroxisome
Disease
H00207  Rhizomelic chondrodysplasia punctata
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00565 Ether lipid metabolism
    8540 (AGPS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    8540 (AGPS)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.26  alkylglycerone-phosphate synthase
     8540 (AGPS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD-oxidase_C FAD_binding_4 BBE
Motif
Other DBs
NCBI-GeneID: 8540
NCBI-ProteinID: NP_003650
OMIM: 603051
HGNC: 327
Ensembl: ENSG00000018510
Vega: OTTHUMG00000132530
Pharos: O00116(Tbio)
UniProt: O00116
Position
2q31.2
AA seq 658 aa AA seqDB search
MAEAAAAAGGTGLGAGASYGSAADRDRDPDPDRAGRRLRVLSGHLLGRPREALSTNECKA
RRAASAATAAPTATPAAQESGTIPKKRQEVMKWNGWGYNDSKFIFNKKGQIELTGKRYPL
SGMGLPTFKEWIQNTLGVNVEHKTTSKASLNPSDTPPSVVNEDFLHDLKETNISYSQEAD
DRVFRAHGHCLHEIFLLREGMFERIPDIVLWPTCHDDVVKIVNLACKYNLCIIPIGGGTS
VSYGLMCPADETRTIISLDTSQMNRILWVDENNLTAHVEAGITGQELERQLKESGYCTGH
EPDSLEFSTVGGWVSTRASGMKKNIYGNIEDLVVHIKMVTPRGIIEKSCQGPRMSTGPDI
HHFIMGSEGTLGVITEATIKIRPVPEYQKYGSVAFPNFEQGVACLREIAKQRCAPASIRL
MDNKQFQFGHALKPQVSSIFTSFLDGLKKFYITKFKGFDPNQLSVATLLFEGDREKVLQH
EKQVYDIAAKFGGLAAGEDNGQRGYLLTYVIAYIRDLALEYYVLGESFETSAPWDRVVDL
CRNVKERITRECKEKGVQFAPFSTCRVTQTYDAGACIYFYFAFNYRGISDPLTVFEQTEA
AAREEILANGGSLSHHHGVGKLRKQWLKESISDVGFGMLKSVKEYVDPNNIFGNRNLL
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggcggcggctgcagcgggtgggactggcttgggcgcgggcgcgagctacggg
tctgcagcggaccgggaccgggacccggacccggaccgcgccgggcggaggctgcgggtt
ctctctggccatctgctgggccggccccgggaggctctgagtaccaatgagtgcaaagcg
cggagagccgcgtcggcggccacggcagcgcccacggccactcccgccgcgcaggagtcg
ggcaccatcccaaagaagcggcaagaagttatgaaatggaatggatggggatataatgat
tctaaattcatcttcaataagaagggccaaattgaattgactgggaaaaggtaccctctt
agtggcatgggtttaccaacatttaaagaatggatccaaaatacccttggagtaaatgtg
gagcataaaactacctctaaagcatccttaaatcctagtgatacacctccttctgttgta
aatgaagattttcttcatgaccttaaagaaactaatatttcatattcacaagaggcagat
gatcgagtatttagagctcatggtcattgtcttcatgagatatttttgctcagggaagga
atgtttgagcgaattcctgatatagttttatggccaacatgccatgatgatgtagttaag
attgtgaatctagcttgcaaatataatctttgtatcataccaattggtggaggaacaagt
gtttcatatggcctgatgtgtcctgcagatgagacaagaacaattatttctttggacact
tcacaaatgaatcgaattctctgggttgatgagaacaatttgacagctcatgtagaggct
ggcataacaggacaagagttggaaagacagcttaaagaaagtggttattgtacaggtcat
gaaccagattccctggagttcagtactgtaggaggatgggtatctactcgcgcatcaggc
atgaagaagaatatctatggcaatatcgaggacctggtggttcatataaaaatggtaaca
cctagaggtataatagaaaaaagctgtcaaggacctcgtatgtcaacaggccctgatatc
catcacttcatcatgggatctgaaggaactcttggtgtaataacagaagctacaataaaa
atcagaccagtccctgaataccaaaagtatggctcagtagctttccctaattttgaacaa
ggagtagcctgtttaagagaaattgcaaaacagagatgtgctccggcatctattcgcctc
atggacaacaagcagtttcagtttggtcatgctcttaaacctcaggtttcctctattttt
acatcatttttggacggattaaaaaagttttatattacaaagtttaaaggatttgaccca
aatcagctaagtgtagccacattactgtttgagggggatcgtgagaaggttcttcaacat
gaaaaacaagtgtatgatattgctgcaaaatttggtgggttggcagctggagaagataat
ggacagagaggttatttgctgacctatgttattgcatacattcgagacttggctttggaa
tactatgtattaggagaatcttttgagacttctgctccttgggacagggtggtagatctc
tgtagaaatgtaaaagaaagaataacaagggaatgcaaagagaagggtgttcagtttgct
cctttttctacatgcagggtgacgcagacttacgatgcaggtgcttgtatctacttctat
tttgcctttaactacaggggaattagtgacccactgaccgtatttgaacaaactgaggca
gctgctagagaagaaatccttgctaatggagggagcctgtcacatcaccatggagtgggc
aagttacggaagcaatggctaaaggaaagtatctctgatgtcggctttgggatgctgaag
tctgtcaaggaatatgtggaccccaataacatctttggaaacagaaaccttttataa

DBGET integrated database retrieval system