KEGG   Homo sapiens (human): 85403Help
Entry
85403             CDS       T01001                                 

Gene name
EAF1
Definition
(RefSeq) ELL associated factor 1
  KO
K15186  ELL-associated factor
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    85403 (EAF1)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Super elongation complex (SEC)
     85403 (EAF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EAF
Motif
Other DBs
NCBI-GeneID: 85403
NCBI-ProteinID: NP_149074
OMIM: 608315
HGNC: 20907
Ensembl: ENSG00000144597
Vega: OTTHUMG00000162544
Pharos: Q96JC9(Tdark)
UniProt: Q96JC9
Position
3p25.1
AA seq 268 aa AA seqDB search
MNGTANPLLDREEHCLRLGESFEKRPRASFHTIRYDFKPASIDTSCEGELQVGKGDEVTI
TLPHIPGSTPPMTVFKGNKRPYQKDCVLIINHDTGEYVLEKLSSSIQVKKTRAEGSSKIQ
ARMEQQPTRPPQTSQPPPPPPPMPFRAPTKPPVGPKTSPLKDNPSPEPQLDDIKRELRAE
VDIIEQMSSSSGSSSSDSESSSGSDDDSSSSGGEDNGPASPPQPSHQQPYNSRPAVANGT
SRPQGSNQLMNTLRNDLQLSESGSDSDD
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgaatgggaccgcaaacccgctgctggaccgcgaggaacattgcctgaggctcggggag
agcttcgagaagcggccgcgggcctccttccacactattcgttatgattttaaaccagca
tctatagacacttcctgtgaaggagagcttcaagttggcaaaggagatgaagtcacaatt
acactgccacatatccctggatccacaccacccatgactgtgttcaaggggaacaaacgg
ccttaccagaaagactgtgtgcttattattaatcatgacactggtgaatatgtgctggaa
aaactcagtagcagcattcaggtgaagaaaacaagagctgagggcagcagtaaaatccag
gcccgaatggaacagcagcccactcgtcctccacagacgtcacagccaccaccacctcca
ccacctatgccattcagagctccaacgaagcctccagttggacccaaaacttctcccttg
aaagataacccctcacctgaacctcagttggatgacatcaaaagagagctgagggctgaa
gttgacattattgaacaaatgagcagcagcagtgggagcagctcttcagactctgagagc
tcttcgggaagtgatgacgatagctccagcagtggaggcgaggacaatggcccagcctct
cctccgcagccttcacaccagcagccctacaacagtaggcctgccgttgccaatggaacc
agccggccacaaggaagcaaccagctcatgaacaccctcagaaatgacttgcagttgagt
gagtctggcagtgacagtgatgactag

DBGET integrated database retrieval system