KEGG   Homo sapiens (human): 85407Help
Entry
85407             CDS       T01001                                 

Gene name
NKD1, Naked1
Definition
(RefSeq) NKD inhibitor of WNT signaling pathway 1
  KO
K03213  naked cuticle
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
hsa04390  Hippo signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    85407 (NKD1)
   04390 Hippo signaling pathway
    85407 (NKD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_6 EF-hand_7 EF-hand_1
Motif
Other DBs
NCBI-GeneID: 85407
NCBI-ProteinID: NP_149110
OMIM: 607851
HGNC: 17045
Ensembl: ENSG00000140807
Vega: OTTHUMG00000133169
Pharos: Q969G9(Tbio)
UniProt: Q969G9
Position
16q12.1
AA seq 470 aa AA seqDB search
MGKLHSKPAAVCKRRESPEGDSFAVSAAWARKGIEEWIGRQRCPGGVSGPRQLRLAGTIG
RSTRELVGDVLRDTLSEEEEDDFRLEVALPPEKTDGLGSGDEKKMERVSEPCPGSKKQLK
FEELQCDVSMEEDSRQEWTFTLYDFDNNGKVTREDITSLLHTIYEVVDSSVNHSPTSSKM
LRVKLTVAPDGSQSKRSVLVNQADLQSARPRAETKPTEDLRSWEKKQRAPLRFQGDSRLE
QSGCYHHCVDENIERRNHYLDLAGIENYTSQFGPGSPSVAQKSELPPRTSNPTRSRSHEP
EAIHIPHRKPQGVDPASFHFLDTPIAKVSELQQRLRGTQDGSKHFVRSPKAQGKSVGVGH
VARGARNKPPLGPAIPAVSPSAHLAASPALLPSLAPLGHKKHKHRAKESQQGCRGLQAPL
ASGGPVLGREHLRELPALVVYESQAGQPVQRHEHHHHHEHHHHYHHFYQT
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggggaaacttcactccaagccggccgccgtgtgcaagcgcagggagagcccggaaggt
gacagcttcgccgtgagcgctgcctgggctcggaagggcatcgaggagtggatcgggaga
cagcgctgcccgggcggtgtctcgggaccccgacagctgcggttggcgggcaccataggc
cgaagcacccgggagctcgtgggcgacgtgttgagagacacgctcagcgaggaagaggag
gacgactttcggctggaagtggccctgcctcctgagaagactgacgggctgggcagcgga
gatgagaagaagatggagagagtgagcgaaccctgcccaggctccaagaagcagctgaag
tttgaagagctccagtgcgacgtgtccatggaggaggacagccggcaggagtggaccttc
accctgtatgactttgacaacaacggcaaggtcacccgagaggacatcaccagcttgctg
cacaccatctatgaggtggtggactcctctgtcaaccactccccaacatccagcaagatg
ctgcgggtaaagctcaccgtggcccccgatggcagccagagcaagaggagcgtccttgtc
aatcaggctgacctgcagagcgcaaggccccgagcagagaccaagcccactgaggacctg
cggagctgggagaagaagcagcgagccccgctcaggttccagggtgacagccgcctggag
cagtctggctgctaccaccattgcgtagatgagaacatcgagaggagaaaccactactta
gatctcgccgggatagaaaactacacgtcccaatttgggcctggctccccttccgtggcc
cagaagtcagaactgcccccccgcacctccaatcccactcgatctcgctcccatgagccg
gaagccatccacatcccacaccgaaagccccaaggcgtggacccggcctccttccacttc
cttgacaccccaatcgccaaggtctcagagctccagcaacggctccggggcacccaggac
gggagcaagcactttgtgaggtcccccaaggcccagggcaagagtgtgggtgtgggccac
gtggccagaggggcaagaaacaagccccctctgggacccgccatccctgcggtgtccccc
tccgcccacctggctgccagcccggccctcctcccctccctagcccccctcgggcacaag
aagcacaagcaccgagccaaggagagccagcagggctgccggggcctgcaggcaccactg
gcctcaggtggccctgtcctggggcgggagcacctgcgggagctgcccgccttggtggtg
tatgagagccaggccgggcagccggtccagagacatgagcaccaccaccaccatgaacat
caccaccattaccaccacttctaccagacatag

DBGET integrated database retrieval system