KEGG   Homo sapiens (human): 85407
Entry
85407             CDS       T01001                                 

Symbol
NKD1, Naked1
Name
(RefSeq) NKD inhibitor of WNT signaling pathway 1
  KO
K03213  naked cuticle
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
hsa04390  Hippo signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    85407 (NKD1)
   04390 Hippo signaling pathway
    85407 (NKD1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    85407 (NKD1)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   85407 (NKD1)
SSDB
Motif
Pfam: EF-hand_6 EF-hand_7 EF-hand_1
Other DBs
NCBI-GeneID: 85407
NCBI-ProteinID: NP_149110
OMIM: 607851
HGNC: 17045
Ensembl: ENSG00000140807
Vega: OTTHUMG00000133169
Pharos: Q969G9(Tbio)
UniProt: Q969G9
Position
16q12.1
AA seq 470 aa
MGKLHSKPAAVCKRRESPEGDSFAVSAAWARKGIEEWIGRQRCPGGVSGPRQLRLAGTIG
RSTRELVGDVLRDTLSEEEEDDFRLEVALPPEKTDGLGSGDEKKMERVSEPCPGSKKQLK
FEELQCDVSMEEDSRQEWTFTLYDFDNNGKVTREDITSLLHTIYEVVDSSVNHSPTSSKM
LRVKLTVAPDGSQSKRSVLVNQADLQSARPRAETKPTEDLRSWEKKQRAPLRFQGDSRLE
QSGCYHHCVDENIERRNHYLDLAGIENYTSQFGPGSPSVAQKSELPPRTSNPTRSRSHEP
EAIHIPHRKPQGVDPASFHFLDTPIAKVSELQQRLRGTQDGSKHFVRSPKAQGKSVGVGH
VARGARNKPPLGPAIPAVSPSAHLAASPALLPSLAPLGHKKHKHRAKESQQGCRGLQAPL
ASGGPVLGREHLRELPALVVYESQAGQPVQRHEHHHHHEHHHHYHHFYQT
NT seq 1413 nt   +upstreamnt  +downstreamnt
atggggaaacttcactccaagccggccgccgtgtgcaagcgcagggagagcccggaaggt
gacagcttcgccgtgagcgctgcctgggctcggaagggcatcgaggagtggatcgggaga
cagcgctgcccgggcggtgtctcgggaccccgacagctgcggttggcgggcaccataggc
cgaagcacccgggagctcgtgggcgacgtgttgagagacacgctcagcgaggaagaggag
gacgactttcggctggaagtggccctgcctcctgagaagactgacgggctgggcagcgga
gatgagaagaagatggagagagtgagcgaaccctgcccaggctccaagaagcagctgaag
tttgaagagctccagtgcgacgtgtccatggaggaggacagccggcaggagtggaccttc
accctgtatgactttgacaacaacggcaaggtcacccgagaggacatcaccagcttgctg
cacaccatctatgaggtggtggactcctctgtcaaccactccccaacatccagcaagatg
ctgcgggtaaagctcaccgtggcccccgatggcagccagagcaagaggagcgtccttgtc
aatcaggctgacctgcagagcgcaaggccccgagcagagaccaagcccactgaggacctg
cggagctgggagaagaagcagcgagccccgctcaggttccagggtgacagccgcctggag
cagtctggctgctaccaccattgcgtagatgagaacatcgagaggagaaaccactactta
gatctcgccgggatagaaaactacacgtcccaatttgggcctggctccccttccgtggcc
cagaagtcagaactgcccccccgcacctccaatcccactcgatctcgctcccatgagccg
gaagccatccacatcccacaccgaaagccccaaggcgtggacccggcctccttccacttc
cttgacaccccaatcgccaaggtctcagagctccagcaacggctccggggcacccaggac
gggagcaagcactttgtgaggtcccccaaggcccagggcaagagtgtgggtgtgggccac
gtggccagaggggcaagaaacaagccccctctgggacccgccatccctgcggtgtccccc
tccgcccacctggctgccagcccggccctcctcccctccctagcccccctcgggcacaag
aagcacaagcaccgagccaaggagagccagcagggctgccggggcctgcaggcaccactg
gcctcaggtggccctgtcctggggcgggagcacctgcgggagctgcccgccttggtggtg
tatgagagccaggccgggcagccggtccagagacatgagcaccaccaccaccatgaacat
caccaccattaccaccacttctaccagacatag

KEGG   Homo sapiens (human): 85409
Entry
85409             CDS       T01001                                 

Symbol
NKD2, Naked2
Name
(RefSeq) NKD inhibitor of WNT signaling pathway 2
  KO
K03213  naked cuticle
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
hsa04390  Hippo signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    85409 (NKD2)
   04390 Hippo signaling pathway
    85409 (NKD2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    85409 (NKD2)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   85409 (NKD2)
SSDB
Motif
Pfam: EF-hand_7 EF-hand_6
Other DBs
NCBI-GeneID: 85409
NCBI-ProteinID: NP_149111
OMIM: 607852
HGNC: 17046
Ensembl: ENSG00000145506
Vega: OTTHUMG00000090348
Pharos: Q969F2(Tbio)
UniProt: Q969F2
Position
5p15.33
AA seq 451 aa
MGKLQSKHAAAARKRRESPEGDSFVASAYASGRKGAEEAERRARDKQELPNGDPKEGPFR
EDQCPLQVALPAEKAEGREHPGQLLSADDGERAANREGPRGPGGQRLNIDALQCDVSVEE
DDRQEWTFTLYDFDNCGKVTREDMSSLMHTIYEVVDASVNHSSGSSKTLRVKLTVSPEPS
SKRKEGPPAGQDREPTRCRMEGELAEEPRVADRRLSAHVRRPSTDPQPCSERGPYCVDEN
TERRNHYLDLAGIENYTSRFGPGSPPVQAKQEPQGRASHLQARSRSQEPDTHAVHHRRSQ
VLVEHVVPASEPAARALDTQPRPKGPEKQFLKSPKGSGKPPGVPASSKSGKAFSYYLPAV
LPPQAPQDGHHLPQPPPPPYGHKRYRQKGREGHSPLKAPHAQPATVEHEVVRDLPPTPAG
EGYAVPVIQRHEHHHHHEHHHHHHHHHFHPS
NT seq 1356 nt   +upstreamnt  +downstreamnt
atggggaaactgcagtcgaagcacgccgccgccgcccgcaagcggagagagagcccggaa
ggggacagcttcgtggcgtccgcgtacgcgagcggccgcaaaggcgcggaggaagcggag
cggcgcgcgcgggacaagcaggagctgcccaatggggaccccaaggaggggcctttccgg
gaggaccagtgtcccctacaggtggcactccccgctgagaaagctgagggccgcgagcac
ccgggacaactcctcagcgcagatgacggagagagggcagcaaaccgcgagggcccgcga
ggaccgggcgggcagcgcctcaacattgacgcactccagtgcgatgtctcggtggaggag
gacgaccgccaggagtggacgttcacgctctatgactttgacaactgcgggaaggtcacc
agggaggacatgtccagcctcatgcacaccatctatgaggtcgtggatgcctcggtcaac
cactcctcgggcagcagcaagaccctccgtgtgaagctaaccgtcagccctgagccctcc
agcaagaggaaggagggtcctcctgctggccaggaccgggagcccacccgttgcaggatg
gagggtgaactggcagaggagccaagggtggctgacaggaggttgtctgcacacgtcagg
aggcccagtactgacccccagccctgctcggagcgggggccctactgcgtggacgagaac
acggagcgcagaaaccactacctggacctcgccgggattgagaactacacgtccagattc
ggccctgggtcccctcctgtgcaagcaaagcaggagccccagggcagggcctcgcacctc
caggcccggtcccgctcccaggagccagatacacatgccgtacaccaccgcaggtcacag
gtgctggtggaacacgtcgtgccagcctcggagcctgctgcccgggccctggacacgcag
ccccggccgaaggggccggagaagcagttcctcaagtcccccaagggctccgggaagccg
cctggggtgccagccagcagcaagtccgggaaagccttcagctactacctgccggccgtc
ctgccgccccaggcccctcaggacggccaccacctcccgcagcccccaccgccaccctac
ggccacaagcggtaccgccaaaagggcagggagggccactcgccactcaaggccccacac
gctcagcctgccacagtggagcacgaggtggtgcgggacctgccgcccacgccagcagga
gagggctacgcggtgccagtgatccagcggcacgagcaccaccaccaccacgagcaccac
caccaccaccaccaccaccacttccacccgtcctag

DBGET integrated database retrieval system