KEGG   Homo sapiens (human): 85413Help
Entry
85413             CDS       T01001                                 

Gene name
SLC22A16, CT2, FLIPT2, HEL-S-18, OAT6, OCT6, OKB1, dJ261K5.1
Definition
(RefSeq) solute carrier family 22 member 16
  KO
K08212  MFS transporter, OCT family, solute carrier family 22 (organic cation transporter), member 16
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    85413 (SLC22A16)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC22: Organic cation/anion/zwitterion transporter
   85413 (SLC22A16)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Organic cation transporter (OCT) family [TC:2.A.1.19]
    85413 (SLC22A16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sugar_tr MFS_1
Motif
Other DBs
NCBI-GeneID: 85413
NCBI-ProteinID: NP_149116
OMIM: 608276
HGNC: 20302
Ensembl: ENSG00000004809
Vega: OTTHUMG00000016171
Pharos: Q86VW1(Tbio)
UniProt: Q86VW1 A0A0K0K1K9
Position
6q21; 6q21-q22.1
AA seq 577 aa AA seqDB search
MGSRHFEGIYDHVGHFGRFQRVLYFICAFQNISCGIHYLASVFMGVTPHHVCRPPGNVSQ
VVFHNHSNWSLEDTGALLSSGQKDYVTVQLQNGEIWELSRCSRNKRENTSSLGYEYTGSK
KEFPCVDGYIYDQNTWKSTAVTQWNLVCDRKWLAMLIQPLFMFGVLLGSVTFGYFSDRLG
RRVVLWATSSSMFLFGIAAAFAVDYYTFMAARFFLAMVASGYLVVGFVYVMEFIGMKSRT
WASVHLHSFFAVGTLLVALTGYLVRTWWLYQMILSTVTVPFILCCWVLPETPFWLLSEGR
YEEAQKIVDIMAKWNRASSCKLSELLSLDLQGPVSNSPTEVQKHNLSYLFYNWSITKRTL
TVWLIWFTGSLGFYSFSLNSVNLGGNEYLNLFLLGVVEIPAYTFVCIAMDKVGRRTVLAY
SLFCSALACGVVMVIPQKHYILGVVTAMVGKFAIGAAFGLIYLYTAELYPTIVRSLAVGS
GSMVCRLASILAPFSVDLSSIWIFIPQLFVGTMALLSGVLTLKLPETLGKRLATTWEEAA
KLESENESKSSKLLLTTNNSGLEKTEAITPRDSGLGE
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atggggtcccgccacttcgaggggatttatgaccacgtggggcacttcggcagattccag
agagtcctctatttcatatgtgccttccagaacatctcttgtggtattcactacttggct
tctgtgttcatgggagtcacccctcatcatgtctgcaggcccccaggcaatgtgagtcag
gttgttttccataatcactctaattggagtttggaggacaccggggccctgttgtcttca
ggccagaaagattatgttacggtgcagttgcagaatggtgagatctgggagctctcaagg
tgtagcaggaataagagggagaacacatcgagtttgggctatgaatacactggcagtaag
aaagagtttccttgtgtggatggctacatatatgaccagaacacatggaaaagcactgcg
gtgacccagtggaacctggtctgtgaccgaaaatggcttgcaatgctgatccagccccta
tttatgtttggagtcctactgggatcggtgacttttggctacttttctgacaggctagga
cgccgggtggtcttgtgggccacaagcagtagcatgtttttgtttggaatagcagcggcg
tttgcagttgattattacaccttcatggctgctcgcttttttcttgccatggttgcaagt
ggctatcttgtggtggggtttgtctatgtgatggaattcattggcatgaagtctcggaca
tgggcgtctgtccatttgcattccttttttgcagttggaaccctgctggtggctttgaca
ggatacttggtcaggacctggtggctttaccagatgatcctctccacagtgactgtcccc
tttatcctgtgctgttgggtgctcccagagacacctttttggcttctctcagagggacga
tatgaagaagcacaaaaaatagttgacatcatggccaagtggaacagggcaagctcctgt
aaactgtcagaacttttatcactggacctacaaggtcctgttagtaatagccccactgaa
gttcagaagcacaacctatcatatctgttttataactggagcattacgaaaaggacactt
accgtttggctaatctggttcactggaagtttgggattctactcgttttccttgaattct
gttaacttaggaggcaatgaatacttaaacctcttcctcctgggtgtagtggaaattccc
gcctacaccttcgtgtgcatcgccatggacaaggtcgggaggagaacagtcctggcctac
tctcttttctgcagtgcactggcctgtggtgtcgttatggtgatcccccagaaacattat
attttgggtgtggtgacagctatggttggaaaatttgccatcggggcagcatttggcctc
atttatctttatacagctgagctgtatccaaccattgtaagatcgctggctgtgggaagc
ggcagcatggtgtgtcgcctggccagcatcctggcgccgttctctgtggacctcagcagc
atttggatcttcataccacagttgtttgttgggactatggccctcctgagtggagtgtta
acactaaagcttccagaaacccttgggaaacggctagcaactacttgggaggaggctgca
aaactggagtcagagaatgaaagcaagtcaagcaaattacttctcacaactaataatagt
gggctggaaaaaacggaagcgattacccccagggattctggtcttggtgaataa

DBGET integrated database retrieval system