KEGG   Homo sapiens (human): 85415
Entry
85415             CDS       T01001                                 
Symbol
RHPN2, P76RBE, RHOBP
Name
(RefSeq) rhophilin Rho GTPase binding protein 2
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: BRO1 HR1 PDZ PDZ_6
Other DBs
NCBI-GeneID: 85415
NCBI-ProteinID: NP_149094
OMIM: 617932
HGNC: 19974
Ensembl: ENSG00000131941
Pharos: Q8IUC4(Tbio)
UniProt: Q8IUC4
Structure
Position
19:complement(32978592..33064888)
AA seq 686 aa
MTDALLPAAPQPLEKENDGYFRKGCNPLAQTGRSKLQNQRAALNQQILKAVRMRTGAENL
LKVATNSKVREQVRLELSFVNSDLQMLKEELEGLNISVGVYQNTEEAFTIPLIPLGLKET
KDVDFAVVLKDFILEHYSEDGYLYEDEIADLMDLRQACRTPSRDEAGVELLMTYFIQLGF
VESRFFPPTRQMGLLFTWYDSLTGVPVSQQNLLLEKASVLFNTGALYTQIGTRCDRQTQA
GLESAIDAFQRAAGVLNYLKDTFTHTPSYDMSPAMLSVLVKMMLAQAQESVFEKISLPGI
RNEFFMLVKVAQEAAKVGEVYQQLHAAMSQAPVKENIPYSWASLACVKAHHYAALAHYFT
AILLIDHQVKPGTDLDHQEKCLSQLYDHMPEGLTPLATLKNDQQRRQLGKSHLRRAMAHH
EESVREASLCKKLRSIEVLQKVLCAAQERSRLTYAQHQEEDDLLNLIDAPSVVAKTEQEV
DIILPQFSKLTVTDFFQKLGPLSVFSANKRWTPPRSIRFTAEEGDLGFTLRGNAPVQVHF
LDPYCSASVAGAREGDYIVSIQLVDCKWLTLSEVMKLLKSFGEDEIEMKVVSLLDSTSSM
HNKSATYSVGMQKTYSMICLAIDDDDKTDKTKKISKKLSFLSWGTNKNRQKSASTLCLPS
VGAARPQVKKKLPSPFSLLNSDSSWY
NT seq 2061 nt   +upstreamnt  +downstreamnt
atgaccgacgcgctgttgcccgcggccccccagccgctggagaaggagaacgacggctac
tttcggaagggctgtaatccccttgcacaaaccggccggagtaaattgcagaatcaaaga
gctgctttgaatcagcagatcctgaaagccgtgcggatgaggaccggagcggaaaacctt
ctgaaagtggccacaaactcaaaggtgcgggagcaagtgcggctggagctgagcttcgtc
aactcagacctgcagatgctcaaggaagagctggaggggctgaacatctcggtgggcgtc
tatcagaacacagaggaggcatttacgattcccctgattcctcttggcctgaaggaaacg
aaagacgtcgactttgcagtcgtcctcaaggattttatcctggaacattacagtgaagat
ggctatttatatgaagatgaaattgcagatcttatggatctgagacaagcttgtcggacg
cctagccgggatgaggccggggtggaactgctgatgacatacttcatccagctgggcttt
gtcgagagtcgattcttcccgcccacacggcagatgggactcctgttcacctggtatgac
tctctcaccggggttccggtcagccagcagaacctgctgctggagaaggccagtgtcctg
ttcaacactggggccctctacacccagattgggacccggtgtgatcggcagacgcaggct
gggctggagagtgccatagatgcctttcagagagccgcaggggttttaaattacctgaaa
gacacatttacccatactccaagttacgacatgagccctgccatgctcagcgtgctcgtc
aaaatgatgcttgcacaagcccaagaaagcgtgtttgagaaaatcagccttcctgggatc
cggaatgaattcttcatgctggtgaaggtggctcaggaggctgctaaggtgggagaggtc
taccaacagctacacgcagccatgagccaggcgccggtgaaagagaacatcccctactcc
tgggccagcttagcctgcgtgaaggcccaccactacgcggccctggcccactacttcact
gccatcctcctcatcgaccaccaggtgaagccaggcacggatctggaccaccaggagaag
tgcctgtcccagctctacgaccacatgccagaggggctgacacccttggccacactgaag
aatgatcagcagcgccgacagctggggaagtcccacttgcgcagagccatggctcatcac
gaggagtcggtgcgggaggccagcctctgcaagaagctgcggagcattgaggtgctacag
aaggtgctgtgtgccgcacaggaacgctcccggctcacgtacgcccagcaccaggaggag
gatgacctgctgaacctgatcgacgcccccagtgttgttgctaaaactgagcaagaggtt
gacattatattgccccagttctccaagctgacagtcacggacttcttccagaagctgggc
cccttatctgtgttttcggctaacaagcggtggacgcctcctcgaagcatccgcttcact
gcagaagaaggggacttggggttcaccttgagagggaacgcccccgttcaggttcacttc
ctggatccttactgctctgcctcggtggcaggagcccgggaaggagattatattgtctcc
attcagcttgtggattgtaagtggctgacgctgagtgaggttatgaagctgctgaagagc
tttggcgaggacgagatcgagatgaaagtcgtgagcctcctggactccacatcatccatg
cataataagagtgccacatactccgtgggaatgcagaaaacgtactccatgatctgctta
gccattgatgatgacgacaaaactgataaaaccaagaaaatctccaagaagctttccttc
ctgagttggggcaccaacaagaacagacagaagtcagccagcaccttgtgcctcccatcg
gtcggggctgcacggcctcaggtcaagaagaagctgccctcccctttcagccttctcaac
tcagacagttcttggtactaa

DBGET integrated database retrieval system