KEGG   Homo sapiens (human): 8542Help
Entry
8542              CDS       T01001                                 

Gene name
APOL1, APO-L, APOL, APOL-I, FSGS4
Definition
(RefSeq) apolipoprotein L1
  KO
K23585  apolipoprotein L1
Organism
hsa  Homo sapiens (human)
Pathway
hsa05143  African trypanosomiasis
Disease
H00626  Focal segmental glomerulosclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05143 African trypanosomiasis
    8542 (APOL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ApoL Metal_resist
Motif
Other DBs
NCBI-GeneID: 8542
NCBI-ProteinID: NP_001130012
OMIM: 603743
HGNC: 618
Ensembl: ENSG00000100342
Vega: OTTHUMG00000030427
Pharos: O14791(Tbio)
UniProt: O14791
Position
22q12.3
AA seq 398 aa AA seqDB search
MEGAALLRVSVLCIWMSALFLGVGVRAEEAGARVQQNVPSGTDTGDPQSKPLGDWAAGTM
DPESSIFIEDAIKYFKEKVSTQNLLLLLTDNEAWNGFVAAAELPRNEADELRKALDNLAR
QMIMKDKNWHDKGQQYRNWFLKEFPRLKSELEDNIRRLRALADGVQKVHKGTTIANVVSG
SLSISSGILTLVGMGLAPFTEGGSLVLLEPGMELGITAALTGITSSTMDYGKKWWTQAQA
HDLVIKSLDKLKEVREFLGENISNFLSLAGNTYQLTRGIGKDIRALRRARANLQSVPHAS
ASRPRVTEPISAESGEQVERVNEPSILEMSRGVKLTDVAPVSFFLVLDVVYLVYESKHLH
EGAKSETAEELKKVAQELEEKLNILNNNYKILQADQEL
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggagggagctgctttgctgagagtctctgtcctctgcatctggatgagtgcacttttc
cttggtgtgggagtgagggcagaggaagctggagcgagggtgcaacaaaacgttccaagt
gggacagatactggagatcctcaaagtaagcccctcggtgactgggctgctggcaccatg
gacccagagagcagtatctttattgaggatgccattaagtatttcaaggaaaaagtgagc
acacagaatctgctactcctgctgactgataatgaggcctggaacggattcgtggctgct
gctgaactgcccaggaatgaggcagatgagctccgtaaagctctggacaaccttgcaaga
caaatgatcatgaaagacaaaaactggcacgataaaggccagcagtacagaaactggttt
ctgaaagagtttcctcggttgaaaagtgagcttgaggataacataagaaggctccgtgcc
cttgcagatggggttcagaaggtccacaaaggcaccaccatcgccaatgtggtgtctggc
tctctcagcatttcctctggcatcctgaccctcgtcggcatgggtctggcacccttcaca
gagggaggcagccttgtactcttggaacctgggatggagttgggaatcacagccgctttg
accgggattaccagcagtaccatggactacggaaagaagtggtggacacaagcccaagcc
cacgacctggtcatcaaaagccttgacaaattgaaggaggtgagggagtttttgggtgag
aacatatccaactttctttccttagctggcaatacttaccaactcacacgaggcattggg
aaggacatccgtgccctcagacgagccagagccaatcttcagtcagtaccgcatgcctca
gcctcacgcccccgggtcactgagccaatctcagctgaaagcggtgaacaggtggagagg
gttaatgaacccagcatcctggaaatgagcagaggagtcaagctcacggatgtggcccct
gtaagcttctttcttgtgctggatgtagtctacctcgtgtacgaatcaaagcacttacat
gagggggcaaagtcagagacagctgaggagctgaagaaggtggctcaggagctggaggag
aagctaaacattctcaacaataattataagattctgcaggcggaccaagaactgtga

DBGET integrated database retrieval system