KEGG   Homo sapiens (human): 8544Help
Entry
8544              CDS       T01001                                 

Gene name
PIR
Definition
(RefSeq) pirin
  KO
K06911  quercetin 2,3-dioxygenase [EC:1.13.11.24]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    8544 (PIR)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.24  quercetin 2,3-dioxygenase
     8544 (PIR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pirin_C Pirin Cupin_2
Motif
Other DBs
NCBI-GeneID: 8544
NCBI-ProteinID: NP_001018119
OMIM: 300931
HGNC: 30048
Ensembl: ENSG00000087842
Vega: OTTHUMG00000021176
Pharos: O00625(Tbio)
UniProt: O00625 A0A024RBX6
Structure
PDB: 

Position
Xp22.2
AA seq 290 aa AA seqDB search
MGSSKKVTLSVLSREQSEGVGARVRRSIGRPELKNLDPFLLFDEFKGGRPGGFPDHPHRG
FETVSYLLEGGSMAHEDFCGHTGKMNPGDLQWMTAGRGILHAEMPCSEEPAHGLQLWVNL
RSSEKMVEPQYQELKSEEIPKPSKDGVTVAVISGEALGIKSKVYTRTPTLYLDFKLDPGA
KHSQPIPKGWTSFIYTISGDVYIGPDDAQQKIEPHHTAVLGEGDSVQVENKDPKRSHFVL
IAGEPLREPVIQHGPFVMNTNEEISQAILDFRNAKNGFERAKTWKSKIGN
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggggtcctccaagaaagttactctctcagtgctcagccgggagcagtcggaaggggtt
ggagcgagggtccggagaagcattggcagacccgagttaaaaaatctggatccgttttta
ctgtttgatgaatttaaaggaggtagaccaggaggatttcctgatcatccacatcgaggt
tttgaaacagtatcctacctcctggaagggggcagcatggcccatgaagacttctgtgga
cacactggtaaaatgaacccaggagatttgcagtggatgactgcgggccggggcattctg
cacgctgagatgccttgctcagaggagccagcccatggcctacaactgtgggttaatttg
aggagctcagagaagatggtggagcctcagtaccaggaactgaaaagtgaagaaatccct
aaacccagtaaggatggtgtgacagttgctgtcatttctggagaagccctgggaataaag
tccaaggtttacactcgcacaccaaccttatatttggacttcaaattggacccaggagcc
aaacattcccaacctatccctaaagggtggacaagcttcatttacacgatatctggagat
gtgtatattgggcccgatgatgcacaacaaaaaatagaacctcatcacacagcagtgctt
ggagaaggtgacagtgtccaggtggagaacaaggatcccaagagaagccactttgtctta
attgctggggagccattaagagaaccagttatccaacatggtccatttgtgatgaacacc
aatgaagagatttctcaagctattcttgatttcagaaacgcaaaaaatgggtttgaaagg
gccaaaacctggaaatcaaagattgggaactag

DBGET integrated database retrieval system