KEGG   Homo sapiens (human): 8545
Entry
8545              CDS       T01001                                 
Symbol
CGGBP1, CGGBP, p20-CGGBP
Name
(RefSeq) CGG triplet repeat binding protein 1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Mei5 AKAP95 zf-C2H2_2 Mut7-C Peptidase_S76 zf-C2H2_12
Other DBs
NCBI-GeneID: 8545
NCBI-ProteinID: NP_001008391
OMIM: 603363
HGNC: 1888
Ensembl: ENSG00000163320
Pharos: Q9UFW8(Tbio)
UniProt: Q9UFW8
Position
3:complement(88051950..88149870)
AA seq 167 aa
MERFVVTAPPARNRSKTALYVTPLDRVTEFGGELHEDGGKLFCTSCNVVLNHVRKSAISD
HLKSKTHTKRKAEFEEQNVRKKQRPLTASLQCNSTAQTEKVSVIQDFVKMCLEANIPLEK
ADHPAVRAFLSRHVKNGGSIPKSDQLRRAYLPDGYENENQLLNSQDC
NT seq 504 nt   +upstreamnt  +downstreamnt
atggagcgatttgtagtaacagcaccacctgctcgaaaccgttctaagactgctttgtat
gtgactcccctggatcgagtcactgagtttggaggtgagctgcatgaagatggaggaaaa
ctcttctgcacttcttgcaatgtggttctgaatcatgttcgcaagtctgccattagtgac
cacctcaagtcaaagactcataccaagaggaaggcagaatttgaagagcagaatgtgaga
aagaagcagaggcccctaactgcatctcttcagtgcaacagtactgcgcaaacagagaaa
gtcagtgttatccaggactttgtgaaaatgtgcctggaagccaacatcccacttgagaag
gctgatcacccagcagtccgtgctttcctatctcgccatgtgaagaatggaggctccata
cctaagtcagaccagctacggagggcatatcttcctgatggatatgagaatgagaatcaa
ctcctcaactcacaagattgttga

DBGET integrated database retrieval system