KEGG   Homo sapiens (human): 85450
Entry
85450             CDS       T01001                                 

Gene name
ITPRIP, DANGER, KIAA1754, bA127L20, bA127L20.2
Definition
(RefSeq) inositol 1,4,5-trisphosphate receptor interacting protein
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Mab-21 DivIC UPF0242 DUF5393 MCU
Other DBs
NCBI-GeneID: 85450
NCBI-ProteinID: NP_001258941
HGNC: 29370
Ensembl: ENSG00000148841
Vega: OTTHUMG00000184003
Pharos: Q8IWB1(Tdark)
UniProt: Q8IWB1
Position
10q25.1
AA seq 547 aa
MAMGLFRVCLVVVTAIINHPLLFPRENATVPENEEEIIRKMQAHQEKLQLEQLRLEEEVA
RLAAEKEALEQVAEEGRQQNETRVAWDLWSTLCMILFLMIEVWRQDHQEGPSPECLGGEE
DELPGLGGAPLQGLTLPNKATLGHFYERCIRGATADAARTREFLEGFVDDLLEALRSLCN
RDTDMEVEDFIGVDSMYENWQVDRPLLCHLFVPFTPPEPYRFHPELWCSGRSVPLDRQGY
GQIKVVRADGDTLSCICGKTKLGEDMLCLLHGRNSMAPPCGDMENLLCATDSLYLDTMQV
MKWFQTALTRAWKGIAHKYEFDLAFGQLDSPGSLKIKFRSGKFMPFNLIPVIQCDDSDLY
FVSHLPREPSEGTPASSTDWLLSFAVYERHFLRTTLKALPEGACHLSCLQIASFLLSKQS
RLTGPSGLSSYHLKTALLHLLLLRQAADWKAGQLDARLHELLCFLEKSLLQKKLHHFFIG
NRKVPEAMGLPEAVLRAEPLNLFRPFVLQRSLYRKTLDSFYEMLKNAPALISEYSLHVPS
DQPTPKS
NT seq 1644 nt   +upstreamnt  +downstreamnt
atggccatggggctcttccgcgtgtgtctggtggtggtgacggccatcatcaaccacccg
ctgctgttcccgcgggagaacgccacagtccccgagaacgaggaggagatcatccgcaag
atgcaggcgcaccaggagaagctgcagctggagcagttgcgcctggaggaggaggtggct
cggctggcggccgaaaaggaggcactggagcaggtggcggaggagggcaggcagcagaac
gagacacgcgtggcctgggacctctggagcaccctctgcatgatcctcttcctgatgatc
gaggtgtggcggcaggaccaccaggaggggccctcacctgagtgcctgggcggtgaggag
gatgagctgcctgggctggggggcgcccccttgcagggcctcaccctgcccaacaaggcc
acgcttggccacttttatgagcgctgcatccggggggccacggccgatgcagcccgtacc
cgggagttcctggaaggcttcgtggatgacttgctggaagccctgaggagcctctgcaac
cgggacaccgacatggaggtggaggacttcattggcgtggacagcatgtacgagaactgg
caggtggacaggccactgctgtgccaccttttcgtgcccttcacaccccccgagccctac
cgcttccacccagagctctggtgctccggccgctcagtgcccctggatcgccagggctac
ggccagatcaaggtggtccgcgccgatggggacacattgagctgcatctgcggcaagacc
aagctcggggaagacatgctgtgtctcctgcacggcaggaacagcatggcgcctccctgc
ggcgacatggagaacctgctgtgtgccacagattccctgtacctggacacgatgcaggtc
atgaagtggttccagacggccctcaccagagcctggaagggcatcgcccacaagtacgag
ttcgacctggcctttggccagctggacagcccggggtccctgaagatcaagttccgttca
gggaagttcatgcccttcaacctgattcctgtgatccagtgtgatgactcggacctgtac
tttgtctcccaccttcccagggagccctctgagggcaccccagcctccagcacagactgg
ctcctgtcctttgctgtctatgagcgacacttcctcaggacgacactaaaggcactgccc
gagggcgcctgccacctcagctgcctgcagatagcatccttcctgctctccaagcagagc
cgcctgaccggtcccagcgggctcagcagctaccacctgaagacggccctactgcacctc
ctactcctccggcaggccgccgactggaaggcggggcagctggacgctcgtctgcacgag
ttgctgtgcttcctggagaagagcttgctccagaagaagctccaccacttcttcatcggc
aaccgcaaggtgcctgaggccatgggactccctgaggccgtgctcagggccgagcccctc
aacctcttccggcccttcgtcctgcagcgaagcctttaccgtaagacactggactccttc
tatgagatgctcaagaatgccccagcgctcattagcgagtattccctacatgtcccctca
gaccagcctaccccaaaaagctga

DBGET integrated database retrieval system