KEGG   Homo sapiens (human): 85451
Entry
85451             CDS       T01001                                 
Symbol
UNK, UNKEMPT, ZC3H5, ZC3HDC5
Name
(RefSeq) unk zinc finger
  KO
K23048  RING finger protein unkempt
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99974 Translation
    85451 (UNK)
SSDB
Motif
Pfam: zf_CCCH_5 zf-CCCH DUF3450 zf-C3HC4_3 zf_CCCH_4 THOC7 DUF4407 DUF4201 Fez1 Filament DUF3560 DUF6468 CENP-Q
Other DBs
NCBI-GeneID: 85451
NCBI-ProteinID: NP_001073888
OMIM: 616375
HGNC: 29369
Ensembl: ENSG00000132478
Pharos: Q9C0B0(Tbio)
UniProt: Q9C0B0 A0A024R8N4
Position
17:75784806..75825799
AA seq 810 aa
MSKGPGPGGSAASSAPPAATAQVLQAQPEKPQHYTYLKEFRTEQCPLFVQHKCTQHRPYT
CFHWHFVNQRRRRSIRRRDGTFNYSPDVYCTKYDEATGLCPEGDECPFLHRTTGDTERRY
HLRYYKTGICIHETDSKGNCTKNGLHCAFAHGPHDLRSPVYDIRELQAMEALQNGQTTVE
GSIEGQSAGAASHAMIEKILSEEPRWQETAYVLGNYKTEPCKKPPRLCRQGYACPYYHNS
KDRRRSPRKHKYRSSPCPNVKHGDEWGDPGKCENGDACQYCHTRTEQQFHPEIYKSTKCN
DMQQSGSCPRGPFCAFAHVEQPPLSDDLQPSSAVSSPTQPGPVLYMPSAAGDSVPVSPSS
PHAPDLSALLCRNSSLGSPSNLCGSPPGSIRKPPNLEGIVFPGESGLAPGSYKKAPGFER
EDQVGAEYLKNFKCQAKLKPHSLEPRSQEQPLLQPKQDMLGILPAGSPLTSSISSSITSS
LAATPPSPVGTSSVPGMNANALPFYPTSDTVESVIESALDDLDLNEFGVAALEKTFDNST
VPHPGSITIGGSLLQSSAPVNIPGSLGSSASFHSASPSPPVSLSSHFLQQPQGHLSQSEN
TFLGTSASHGSLGLNGMNSSIWEHFASGSFSPGTSPAFLSGPGAAELARLRQELDEANST
IKQWEESWKQAKQACDAWKKEAEEAGERASAAGAECELAREQRDALEVQVKKLQEELERL
HAGPEPQALPAFSDLEALSLSTLYSLQKQLRAHLEQVDKAVFHMQSVKCLKCQEQKRAVL
PCQHAALCELCAEGSECPICQPGRAHTLQS
NT seq 2433 nt   +upstreamnt  +downstreamnt
atgtcgaagggccccgggcccggcggctccgcagcttcctcggcgcccccggccgctacc
gctcaggtgctgcaggcacagcccgagaaaccgcagcactacacgtacctgaaagaattc
cgcacagagcagtgcccactctttgtgcaacacaaatgcacgcagcatcggccctacacc
tgcttccactggcacttcgtgaaccagcggcgccgccggtccatccgccgtcgggacggc
accttcaattacagccctgacgtctactgcaccaagtacgacgaggctacaggcctctgc
ccggagggcgacgagtgcccattcctgcacagaaccacaggggacactgagcgcaggtac
caccttcgttactacaaaactggaatctgcatccacgagacagactcgaaaggcaactgc
accaaaaacggcctgcactgcgcttttgcccacgggccccatgacctccgctcccctgtc
tacgacatcagggagcttcaggccatggaggccttgcagaatggccagaccacggtagag
gggagcatagagggccagtcggctggggctgcgagccatgccatgatagaaaagatcctc
agcgaggagcctcggtggcaagagactgcttatgtgctggggaactataagacggagcct
tgcaagaagcccccgcggctgtgccgccaaggctatgcctgtccctactaccacaacagc
aaggaccggcggcggagcccccggaagcacaaatacaggtcgtctccatgtccaaacgtc
aagcacggggatgagtggggagaccctggcaagtgtgagaacggagacgcctgccagtac
tgccacacccgcaccgagcagcagttccaccccgagatctacaagtccaccaagtgcaac
gacatgcagcagtcgggcagctgtccccgaggacccttctgcgcctttgcccacgtagaa
cagccacccctgagtgacgacctgcagccttcctcagctgtgtccagccccacccagcca
ggtcctgtcctgtacatgccatctgccgccggagactcggtgcctgtgagcccctccagc
ccgcatgcccctgacctcagtgccctcctctgtagaaacagcagcctaggcagcccgtct
aacctctgcggctccccaccgggctccatcaggaagcccccaaacctggagggcatcgtc
ttccctggggagtctggcctggcccctggcagctataagaaggctcccggcttcgagagg
gaagaccaggtgggagccgagtacctgaaaaatttcaaatgccaggccaaattaaaaccc
cactcattagagcccaggagtcaagagcagcctctgcttcagcccaaacaggacatgctg
ggcatcctccccgcaggcagccccctgacctcaagcatctcttctagtatcacctccagc
ctggcagctaccccccctagcccagtgggcaccagcagcgtccccggcatgaatgcaaac
gctctgcccttctaccccaccagcgacacggtagagtcagtcatagagtctgctttggat
gacctggacctgaatgagtttggcgtggccgccctggagaagactttcgataacagcaca
gtgccccacccaggaagcatcaccatcggcggcagcttgctgcagagctctgcacccgtg
aacatccccggctccttgggcagctctgcctccttccactcagcatccccgtcccctccc
gtcagcctctcctcgcatttcctgcagcagccccagggccacctgagtcagtcggaaaac
acatttttgggaacctcagcatcacatggatctttgggtctgaacgggatgaacagcagc
atctgggagcattttgcctctggaagcttctccccgggcacttcccccgctttcctatca
gggccaggggctgccgagctggcccgacttcggcaagagctggatgaagccaacagcacc
atcaagcagtgggaggagtcctggaagcaggccaagcaggcttgtgatgcctggaagaaa
gaggcggaggaggctggtgagcgggccagtgcggcgggcgccgagtgcgagctggcccgg
gagcagcgggatgcactggaggtgcaggtgaagaagctccaggaggagctggagcggcta
cacgcggggcctgagccccaggccctgcccgccttctccgacctggaggcgctctcactc
tccaccctctactccctccagaaacaactgcgggcccacctggaacaagtggacaaggcc
gtgttccacatgcagtcggtgaaatgccttaagtgtcaggaacagaagcgggcagtgctg
ccgtgccaacacgctgcgctgtgtgagctctgcgctgagggcagcgagtgccccatctgc
cagcctggccgggcccacaccctccagtcgtga

DBGET integrated database retrieval system