KEGG   Homo sapiens (human): 85456
Entry
85456             CDS       T01001                                 

Gene name
TNKS1BP1, TAB182
Definition
(RefSeq) tankyrase 1 binding protein 1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Tankyrase_bdg_C
Other DBs
NCBI-GeneID: 85456
NCBI-ProteinID: NP_203754
OMIM: 607104
HGNC: 19081
Ensembl: ENSG00000149115
Vega: OTTHUMG00000167022
Pharos: Q9C0C2(Tbio)
UniProt: Q9C0C2 A0A024R542
Position
11q12.1
AA seq 1729 aa
MKVSTLRESSAMASPLPREMEEELVPTGSEPGDTRAKPPVKPKPRALPAKPALPAKPSLL
VPVGPRPPRGPLAELPSARKMNMLAGPQPYGGSKRPLPFAPRPAVEASTGGEATQETGKE
EAGKEEPPPLTPPARCAAPGGVRKAPAPFRPASERFAATTVEEILAKMEQPRKEVLASPD
RLWGSRLTFNHDGSSRYGPRTYGTTTAPRDEDGSTLFRGWSQEGPVKSPAECREEHSKTP
EERSLPSDLAFNGDLAKAASSELPADISKPWIPSSPAPSSENGGPASPGLPAEASGSGPG
SPHLHPPDKSSPCHSQLLEAQTPEASQASPCPAVTPSAPSAALPDEGSRHTPSPGLPAEG
APEAPRPSSPPPEVLEPHSLDQPPATSPRPLIEVGELLDLTRTFPSGGEEEAKGDAHLRP
TSLVQRRFSEGVLQSPSQDQEKLGGSLAALPQGQGSQLALDRPFGAESNWSLSQSFEWTF
PTRPSGLGVWRLDSPPPSPITEASEAAEAAEAGNLAVSSREEGVSQQGQGAGSAPSGSGS
SWVQGDDPSMSLTQKGDGESQPQFPAVPLEPLPTTEGTPGLPLQQAEERYESQEPLAGQE
SPLPLATREAALPILEPVLGQEQPAAPDQPCVLFADAPEPGQALPVEEEAVTLARAETTQ
ARTEAQDLCRASPEPPGPESSSRWLDDLLASPPPSGGGARRGAGAELKDTQSPSTCSEGL
LGWSQKDLQSEFGITGDPQPSSFSPSSWCQGASQDYGLGGASPRGDPGLGERDWTSKYGQ
GAGEGSTREWASRCGIGQEEMEASSSQDQSKVSAPGVLTAQDRVVGKPAQLGTQRSQEAD
VQDWEFRKRDSQGTYSSRDAELQDQEFGKRDSLGTYSSRDVSLGDWEFGKRDSLGAYASQ
DANEQGQDLGKRDHHGRYSSQDADEQDWEFQKRDVSLGTYGSRAAEPQEQEFGKSAWIRD
YSSGGSSRTLDAQDRSFGTRPLSSGFSPEEAQQQDEEFEKKIPSVEDSLGEGSRDAGRPG
ERGSGGLFSPSTAHVPDGALGQRDQSSWQNSDASQEVGGHQERQQAGAQGPGSADLEDGE
MGKRGWVGEFSLSVGPQREAAFSPGQQDWSRDFCIEASERSYQFGIIGNDRVSGAGFSPS
SKMEGGHFVPPGKTTAGSVDWTDQLGLRNLEVSSCVGSGGSSEARESAVGQMGWSGGLSL
RDMNLTGCLESGGSEEPGGIGVGEKDWTSDVNVKSKDLAEVGEGGGHSQARESGVGQTDW
SGVEAGEFLKSRERGVGQADWTPDLGLRNMAPGAVCSPGESKELGVGQMDWGNNLGLRDL
EVTCDPDSGGSQGLRGCGVGQMDWTQDLAPQNVELFGAPSEAREHGVGGVSQCPEPGLRH
NGSLSPGLEARDPLEARELGVGETSGPETQGEDYSSSSLEPHPADPGMETGEALSFGASP
GRCPARPPPSGSQGLLEEMLAASSSKAVARRESAASGLGGLLEEEGAGAGAAQEEVLEPG
RDSPPSWRPQPDGEASQTEDVDGTWGSSAARWSDQGPAQTSRRPSQGPPARSPSQDFSFI
EDTEILDSAMYRSRANLGRKRGHRAPVIRPGGTLGLSEAADSDAHLFQDSTEPRASRVPS
SDEEVVEEPQSRRTRMSLGTKGLKVNLFPGLSPSALKAKLRPRNRSAEEGELAESKSSQK
ESAVQRSKSCKVPGLGKPLTLPPKPEKSSGSEGSSPNWLQALKLKKKKV
NT seq 5190 nt   +upstreamnt  +downstreamnt
atgaaagtgtctactctcagggaaagctcagccatggcttccccactgccccgggagatg
gaggaggagctggtgcctactggctctgagccaggtgacactcgggccaaaccccctgtc
aagcccaaaccccgggccctgcctgccaagccagccctgcctgccaaacccagcctgctg
gtgcctgttgggcctcggcctccccggggtcccctggctgagttgccttctgccaggaag
atgaacatgctggcaggaccccagccctatggtggcagcaagcgcccccttccctttgca
ccaaggcctgcggttgaggcctccactggaggagaagccacccaagagactgggaaagag
gaggctgggaaagaggagccaccccctttgacacccccagctcgatgtgcagccccaggg
ggtgtacggaaggcccctgcccctttccgcccagcctcagagcgcttcgcggccaccacg
gtggaagagatcctggccaagatggagcagcctcggaaggaggtccttgccagccccgac
cgcctgtggggttcccgcctcacctttaaccacgatggcagctcgcgatatggccccagg
acctatggcacgaccactgctcccagggatgaggatggcagcaccctcttcaggggatgg
tcccaggaggggccagtaaagtctccagcagagtgccgggaagagcacagcaagacccct
gaggagaggagccttccttccgacctggccttcaacggggacctggctaaggcagccagc
tcggagctacctgctgatatttccaagccctggattccctcaagtccagccccctcctca
gagaatggaggccctgccagcccaggcctccccgcagaagcctcaggctcaggccctggc
tctccccatcttcacccgcctgataagagttctccctgccactcacagcttctggaagcc
cagactcctgaagcttcccaggcttctccctgccccgctgtgactccatcagctccaagt
gcagccctgcctgacgagggctcccgccacacccccagcccggggctccctgccgagggg
gctccagaggcccccagacccagcagcccaccccctgaggtcttggagccccatagcctg
gatcagccccctgccacctcaccccggcccctgatcgaggtgggtgagttgctggatctc
actcggacgtttccatctggcggggaggaggaggccaagggtgacgcacacctccgcccc
accagcctggttcagcgccgattctctgaaggtgtgctccagtcacccagtcaggaccag
gagaagctggggggctcgctggctgccctgccccaaggccaggggagccagttggccctg
gatcgtccctttggggcagagtccaactggagcttatcacagtccttcgaatggaccttc
cccacgaggccctcgggtctgggcgtgtggcggctggactccccgcctccctcccccatc
actgaagccagtgaggccgccgaggctgctgaggctggcaacttggccgtttccagcagg
gaagaaggagtgtctcagcaggggcaaggggctgggtcagctccaagtgggtcaggaagt
tcctgggtgcagggggatgatccaagcatgtccctcacccagaagggcgatggggagagt
caacctcaattcccagctgttccccttgagcccctgcctacaactgagggcacacctgga
ttacctttgcagcaggcagaggagagatacgagtcgcaggagcccttggctggacaggag
tcccctctccccctggctaccagggaggcagccttgcccatcctggagccagtcctgggg
caggagcagccagcagcccctgaccagccctgtgttctctttgctgatgcccctgagcct
ggacaggcactgcctgttgaggaggaggccgtgaccctagcccgggctgagaccacccaa
gccaggacagaggctcaagacttgtgtagggcatcccccgagcctccaggccctgaaagc
agctcccgctggctggacgacctcctggcttcaccaccacccagtggtggcggtgcaagg
cggggagctggagctgagctgaaggacacacagtccccaagtacctgctctgagggactc
cttggctggtcccagaaagatctgcagagtgaatttgggatcacaggagacccacagccc
agcagtttcagtccttccagctggtgtcaaggtgcttctcaggactatggccttgggggt
gcaagccctagaggagacccaggtctcggagagagggactggaccagcaagtatgggcaa
ggagcaggggaagggagcaccagggagtgggccagcaggtgtggcatcggccaggaggag
atggaggccagcagcagccaagaccagagtaaagtgtctgccccaggggtgctcacagcc
caggaccgggtagttggaaagccagcccagcttggcactcagcggagccaggaggcagat
gttcaggactgggagttcagaaagagggattcccagggcacttactccagccgggatgca
gaactccaggaccaggaattcggaaagagagattcactgggtacctacagtagtcgagat
gtaagccttggggactgggaatttgggaagagagattctctgggtgcttatgccagccaa
gatgccaacgagcagggccaagatttggggaagagggaccaccatggtaggtacagcagc
caggatgccgatgagcaggactgggagtttcagaagagagatgtgtcactcggcacctat
ggcagccgggctgcggagccacaggaacaggagtttgggaagagcgcttggataagggac
tacagcagtggtggcagctccaggacccttgacgcccaggacagaagctttggaacgaga
cccctgagctctgggttcagccccgaggaagcccagcaacaggatgaggaatttgagaag
aagattccaagtgtggaagacagccttggagagggcagcagggatgctggccggccagga
gagagaggatccgggggcttgttcagtcctagcactgcccacgtgccggatggggcactc
gggcagagagaccagagcagctggcaaaacagtgatgctagccaggaggtgggagggcat
caggagagacagcaggcaggggctcagggccctggcagtgctgacctggaagatggggag
atgggaaagcgaggctgggtcggtgagtttagcctcagtgttggcccccagcgagaggca
gcatttagcccagggcagcaggactggagccgggacttctgcatcgaggccagtgagagg
agctatcagtttggcatcattggcaacgacagagtgagtggtgctggctttagcccttct
agcaagatggaaggtggtcactttgtgcctcctgggaagaccacagctggctcggtggac
tggactgaccagctgggtctcaggaacttggaagtgtccagctgtgtgggttctgggggc
tcgagcgaggccagggagagtgccgtgggacagatgggctggtcaggtggcctgagcttg
agagacatgaacctgaccggctgtttggaaagtggagggtctgaagagccggggggaatc
ggagttggggagaaggactggacttctgatgttaatgtgaagagcaaagatttggctgag
gtcggggagggaggaggccacagccaggccagagagagtggcgtggggcagactgactgg
tcaggtgtggaggccggagagttccttaaatcaagggagcgtggagttggacaggcagac
tggacacctgaccttgggctgagaaacatggccccaggggcagtctgcagtcctggagag
tccaaagagcttggggtgggccagatggactggggtaacaatctgggcctgagggatttg
gaggtgacctgtgacccagactctggaggttctcaggggctacggggatgtggagtgggg
cagatggactggacccaggacttggcgccccagaatgtggagctctttggggctccaagt
gaagccagggagcatggggtgggcggggtgagccagtgcccagagcccggcctgaggcac
aatggcagcttgtctcctggcctggaggccagagaccccttggaggccagggagctgggg
gttggtgagacaagtgggccagagacccagggtgaagattactcctcgtcttccttggag
ccacaccctgcagaccctggaatggagacaggagaagccctcagcttcggagcaagccct
ggcaggtgcccggcccgccccccaccctccggctcccagggcctgctggaggagatgctg
gcagccagcagctccaaggcggtggctcggagggagtcagcggcctcgggccttgggggc
ctgttggaggaggaaggagccggggcaggtgctgcccaagaggaggtgctggagcctggc
agggactctccaccctcctggaggccgcagcctgatggtgaggccagccagacagaagac
gtggatggcacctggggctcttcagcagccaggtggagcgatcaggggccagcacagact
tctcggcgaccctcccaaggccctcctgccagatcccccagtcaggacttctccttcatt
gaggacaccgagatcctcgacagtgccatgtatcggagccgtgccaacttggggcgcaag
cgtgggcaccgggccccggtcattcggcctgggggtaccttgggcctgtcggaggcagca
gactcggatgcacacctgttccaggactctacagagccacgggcatctcgggtgccatct
tcagatgaagaggtagtggaggaacctcagagccgccggacacggatgtcgttgggcacc
aaggggctgaaagtcaacctctttcctggcctgagcccctcagccctgaaggccaagctg
cgcccccggaatcgctcagctgaggagggagagctggctgagagcaagtcgagccagaag
gagtccgcggtccagcgttcgaaatcctgcaaggtcccaggactgggaaagcccctcacg
ttacctcccaagccagagaaatcctcagggtcagaaggatcgtcgcccaactggcttcaa
gccctgaaactgaagaagaagaaggtctga

DBGET integrated database retrieval system