KEGG   Homo sapiens (human): 85457
Entry
85457             CDS       T01001                                 
Symbol
CIPC, KIAA1737
Name
(RefSeq) CLOCK interacting pacemaker
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: CiPC
Other DBs
NCBI-GeneID: 85457
NCBI-ProteinID: NP_219494
OMIM: 616995
HGNC: 20365
Ensembl: ENSG00000198894
Pharos: Q9C0C6(Tdark)
UniProt: Q9C0C6
Position
14:77098258..77117287
AA seq 399 aa
MERKNPSRESPRRLSAKVGKGTEMKKVARQLGMAAAESDKDSGFSDGSSECLSSAEQMES
EDMLSALGWSREDRPRQNSKTAKNAFPTLSPMVVMKNVLVKQGSSSSQLQSWTVQPSFEV
ISAQPQLLFLHPPVPSPVSPCHTGEKKSDSRNYLPILNSYTKIAPHPGKRGLSLGPEEKG
TSGVQKKICTERLGPSLSSSEPTKAGAVPSSPSTPAPPSAKLAEDSALQGVPSLVAGGSP
QTLQPVSSSHVAKAPSLTFASPASPVCASDSTLHGLESNSPLSPLSANYSSPLWAAEHLC
RSPDIFSEQRQSKHRRFQNTLVVLHKSGLLEITLKTKELIRQNQATQVELDQLKEQTQLF
IEATKSRAPQAWAKLQASLTPGSSNTGSDLEAFSDHPAI
NT seq 1200 nt   +upstreamnt  +downstreamnt
atggagaggaaaaacccatccagagagagccccagaagactctctgccaaagtaggcaaa
ggcacagagatgaagaaagtggctcgtcagcttgggatggctgctgctgagtcagacaag
gactctggcttttcagatgggagctcggaatgtctgagctctgcagagcagatggagtcc
gaggacatgctgagcgccttaggctggagcagagaagacaggccgaggcagaactccaaa
actgcaaagaatgccttccctaccctgtctcccatggtcgtcatgaagaatgtgcttgtc
aaacagggcagcagctcatcccagctccagtcgtggactgtccagccctcctttgaagtg
atctcagcacagccacagctcttattccttcatccacctgtaccatctcctgtcagtcca
tgtcacactggtgagaaaaagtccgactccaggaactacttgcccattctgaattcttac
accaaaatagccccacatccaggcaaaaggggcctttcccttggcccagaagaaaaagga
acaagtggagtgcagaagaaaatctgtactgagagacttgggcctagcttgtcttccagt
gagccaaccaaggctggtgctgtcccatccagtccctcgacgccagcaccacccagcgcc
aaacttgccgaggactcagctctgcagggtgtgccctctctggtggcaggtggaagtcca
cagactcttcagccggtatccagcagtcacgtggctaaagctcccagtctgaccttcgct
tcccccgccagtcctgtctgcgcatcagacagcactctccatgggttagagagcaactct
cccctttcaccactgtccgctaattatagctcacctttatgggctgcagagcacctctgc
cgcagcccagatatcttttcagagcagcggcagagcaaacataggcgctttcagaatacc
ctagtagtcctacataaatctggtttgctggagatcactttgaaaaccaaggagttgatt
cgtcagaatcaggcaactcaggtagaactagaccagctaaaggagcaaacccagctgttt
atagaagccaccaagagcagggcccctcaggcttgggccaagctgcaggcatctttaaca
cctgggtccagtaatacaggcagtgacctagaagcattctctgatcacccagccatatag

DBGET integrated database retrieval system