KEGG   Homo sapiens (human): 85458Help
Entry
85458             CDS       T01001                                 

Gene name
DIXDC1, CCD1
Definition
(RefSeq) DIX domain containing 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: DIX CH CAMSAP_CH CH_2 Thiamine_BP
Motif
Other DBs
NCBI-GeneID: 85458
NCBI-ProteinID: NP_001033043
OMIM: 610493
HGNC: 23695
Ensembl: ENSG00000150764
Vega: OTTHUMG00000166912
Pharos: Q155Q3(Tbio)
UniProt: Q155Q3
Structure
PDB: 

Position
11q23.1
AA seq 683 aa AA seqDB search
MLACLTRGNLLDVLQEGFNEQQLQAYVAWVNAQLKKRPAVKPVQDLRQDLRDGVILAYLI
EIVAGEKLSGVQLSPGNQQEMKNNVEKVLQFVASKKIRMHQTSAKDIVDGNLKSIMRLVL
ALAAHFKPGSSRTVNQGRDSRAPLQSHRPHCATAVAQGAAAALADVCHDMSRSGRDVFRY
RQRNSSMDEEIENPYWSVRALVQQYEGQQRSPSESSCSSLTSPSPIHSAKSESIITQSEE
KADFVIIPAEGIENRTEGTDSPLSRDWRPGSPGTYLETSWEEQLLEQQEYLEKEMEEAKK
MISGLQALLLNGSLPEDEQERPLALCEPGVNPEEQLIIIQSRLDQSMEENQDLKKELLKC
KQEARNLQGIKDALQQRLTQQDTSVLQLKQELLRANMDKDELHNQNVDLQRKLDERNRLL
GEYKKELGQKDRLLQQHQAKLEEALRKLSDVSYHQVDLERELEHKDVLLAHCMKREADEA
TNYNSHNSQSNGFLLPTAGKGATSVSNRGTSDLQLVRDALRSLRNSFSGHDPQHHTIDSL
EQGISSLMERLHVMETQKKQERKVRVKSPRTQVGSEYRESWPPNSKLPHSQSSPTVSSTC
TKVLYFTDRSLTPFMVNIPKRLEEVTLKDFKAAIDREGNHRYHFKALDPEFGTVKEEIFH
DDDAIPGWEGKIVAWVEEDHGEN
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgctagcctgcctgacccgagggaacttactggacgtcctgcaggagggcttcaatgag
caacagctgcaggcctatgtggcctgggtgaatgcacagctgaagaagaggccagcagtg
aagcctgtgcaggacctgcgacaagatctccgggatggggtgatcctggcatatctcatc
gagattgttgcaggagaaaagctgagtggggtacagctgagtcccggtaaccaacaggag
atgaagaataatgtggagaaagtgctacagtttgtggcctctaaaaagattcgtatgcac
cagacttcggctaaagatattgtggatggaaacctgaagtctatcatgaggctggtcctt
gccttggcagctcatttcaaacctggctccagcaggacggtgaaccaaggacgggactcc
agagcccctctgcaaagtcaccgaccacactgtgccactgctgttgcccagggagcagct
gctgctctggccgatgtgtgtcatgacatgtcccgatcaggacgggatgtctttcgatat
agacagaggaacagcagcatggatgaggaaattgagaatccatactggagtgtgcgggcc
ctagtgcagcagtacgaagggcaacaaaggtccccgtctgaatccagctgctccagcctg
acttcacccagtccaatccacagtgcaaagagcgagtccattataacccagtcagaagag
aaggcagattttgtgattattcccgctgaaggaatagagaacagaacagaagggacagat
tctccattatctcgagactggcggccagggagccctggaacctatctggagacctcatgg
gaagaacagctgttggaacaacaagaatatttagaaaaagaaatggaggaagcaaagaaa
atgatatcaggactacaggccttactgctcaatggatccttacctgaagatgaacaggag
aggcccttggccctctgtgaaccaggtgtcaatcccgaggaacaactgattataatccaa
agtcgtctggatcagagtatggaggagaatcaggacttaaagaaggaactgctgaaatgt
aaacaagaagccagaaacttacaggggataaaggatgccttgcagcagagattgactcag
caggacacatctgttcttcagctcaaacaagagctactgagggcaaatatggacaaagat
gagctgcacaaccagaatgtggatctgcagaggaagctagatgagaggaaccggctcttg
ggagaatataaaaaagagctggggcagaaggatcgccttcttcagcagcaccaggccaag
ttagaagaagcactccggaaactctctgatgtcagttaccaccaggtggatctagagcga
gagctagaacacaaagatgtcctcttggctcactgtatgaaaagagaggcagatgaggcg
accaactacaacagtcacaactctcaaagcaatggttttctccttccaacggcaggaaaa
ggagctacttcagtcagcaacagagggaccagcgacctgcagcttgttcgagatgctctc
cgcagcctgcgcaacagcttcagtggccacgatcctcagcaccacactattgacagcttg
gagcagggcatttctagcctcatggagcgcctgcatgttatggagacgcagaagaaacaa
gaaagaaaggttcgggtcaagtcacccagaactcaagtaggtagtgaataccgggagtcc
tggccccctaactcaaagttgcctcactcacagagctctccaactgtcagcagcacctgt
actaaagtgctctatttcactgaccggtcacttacgcccttcatggtcaatataccaaag
aggttggaggaggtgacgttaaaggattttaaagcagctattgatcgggaaggaaatcac
cggtatcacttcaaagcactggatcctgagtttggcactgtcaaagaggagattttccat
gatgatgatgccatccctggatgggaagggaaaattgtagcttgggtggaagaagaccat
ggagagaattaa

DBGET integrated database retrieval system