KEGG   Homo sapiens (human): 85464Help
Entry
85464             CDS       T01001                                 

Gene name
SSH2, SSH-2, SSH-2L
Definition
(RefSeq) slingshot protein phosphatase 2
  KO
K05766  protein phosphatase slingshot [EC:3.1.3.16 3.1.3.48]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
hsa04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    85464 (SSH2)
 09150 Organismal Systems
  09158 Development
   04360 Axon guidance
    85464 (SSH2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    85464 (SSH2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     85464 (SSH2)
    3.1.3.48  protein-tyrosine-phosphatase
     85464 (SSH2)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Slingshots
    85464 (SSH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc DEK_C Y_phosphatase
Motif
Other DBs
NCBI-GeneID: 85464
NCBI-ProteinID: NP_203747
OMIM: 606779
HGNC: 30580
Ensembl: ENSG00000141298
Vega: OTTHUMG00000132752
Pharos: Q76I76(Tdark)
UniProt: Q76I76
Structure
PDB: 

Position
17q11.2
AA seq 1423 aa AA seqDB search
MALVTVQRSPTPSTTSSPCASEADSGEEECRSQPRSISESFLTVKGAALFLPRGNGSSTP
RISHRRNKHAGDLQQHLQAMFILLRPEDNIRLAVRLESTYQNRTRYMVVVSTNGRQDTEE
SIVLGMDFSSNDSSTCTMGLVLPLWSDTLIHLDGDGGFSVSTDNRVHIFKPVSVQAMWSA
LQSLHKACEVARAHNYYPGSLFLTWVSYYESHINSDQSSVNEWNAMQDVQSHRPDSPALF
TDIPTERERTERLIKTKLREIMMQKDLENITSKEIRTELEMQMVCNLREFKEFIDNEMIV
ILGQMDSPTQIFEHVFLGSEWNASNLEDLQNRGVRYILNVTREIDNFFPGVFEYHNIRVY
DEEATDLLAYWNDTYKFISKAKKHGSKCLVHCKMGVSRSASTVIAYAMKEYGWNLDRAYD
YVKERRTVTKPNPSFMRQLEEYQGILLASKQRHNKLWRSHSDSDLSDHHEPICKPGLELN
KKDITTSADQIAEVKTMESHPPIPPVFVEHMVPQDANQKGLCTKERMICLEFTSREFHAG
QIEDELNLNDINGCSSGCCLNESKFPLDNCHASKALIQPGHVPEMANKFPDLTVEDLETD
ALKADMNVHLLPMEELTSPLKDPPMSPDPESPSPQPSCQTEISDFSTDRIDFFSALEKFV
ELSQETRSRSFSHSRMEELGGGRNESCRLSVVEVAPSKVTADDQRSSSLSNTPHASEESS
MDEEQSKAISELVSPDIFMQSHSENAISVKEIVTEIESISQGVGQIQLKGDILPNPCHTP
KKNSIHELLLERAQTPENKPGHMEQDEDSCTAQPELAKDSGMCNPEGCLTTHSSIADLEE
GEPAEGEQELQGSGMHPGAKWYPGSVRRATLEFEERLRQEQEHHGAAPTCTSLSTRKNSK
NDSSVADLAPKGKSDEAPPEHSFVLKEPEMSKGKGKYSGSEAGSLSHSEQNATVPAPRVL
EFDHLPDPQEGPGSDTGTQQEGVLKDLRTVIPYQESETQAVPLPLPKRVEIIEYTHIVTS
PNHTGPGSEIATSEKSGEQGLRKVNMEKSVTVLCTLDENLNRTLDPNQVSLHPQVLPLPH
SSSPEHNRPTDHPTSILSSPEDRGSSLSTALETAAPFVSHTTHLLSASLDYLHPQTMVHL
EGFTEQSSTTDEPSAEQVSWEESQESPLSSGSEVPYKDSQLSSADLSLISKLGDNTGELQ
EKMDPLPVACRLPHSSSSENIKSLSHSPGVVKERAKEIESRVVFQAGLTKPSQMRRSASL
AKLGYLDLCKDCLPEREPASCESPHLKLLQPFLRTDSGMHAMEDQESLENPGAPHNPEPT
KSFVEQLTTTECIVQSKPVERPLVQYAKEFGSSQQYLLPRAGLELTSSEGGLPVLQTQGL
QCACPAPGLAVAPRQQHGRTHPLRRLKKANDKKRTTNPFYNTM
NT seq 4272 nt NT seq  +upstreamnt  +downstreamnt
atggctttggtcacggtccagcggtcacctacccccagcaccacctccagcccctgcgcc
tcggaggcagacagtggggaggaagaatgccggtcacagcccaggagcatcagcgagagc
tttctaactgtcaaaggtgctgccctttttctaccacggggaaatggctcatccacacca
agaatcagccacagacggaacaagcatgcaggcgatctccaacagcatctccaagcaatg
ttcattttactccgcccagaagacaacatcaggctggctgtaagactggaaagtacttac
cagaatcgaacacgctatatggtagtggtttcaactaatggtagacaagacactgaagaa
agcatcgtcctaggaatggatttctcctctaatgacagtagcacttgtaccatgggctta
gttttgcctctctggagcgacacgctaattcatttggatggtgatggtgggttcagtgta
tcgacggataacagagttcacatattcaaacctgtatctgtgcaggcaatgtggtctgca
ctacagagcttacacaaggcttgtgaagtcgccagagcgcataactactacccaggcagc
ctatttctcacttgggtgagttattatgagagccatatcaactcagatcaatcctcagtc
aatgaatggaatgcaatgcaagatgtacagtcccaccggcccgactctccagctctcttc
accgacatacctactgaacgtgaacgaacagaaaggctaattaaaaccaaattaagggag
atcatgatgcagaaggatttggagaatattacatccaaagagataagaacagagttggaa
atgcaaatggtgtgcaacttgcgggaattcaaggaatttatagacaatgaaatgatagtg
atccttggtcaaatggatagccctacacagatatttgagcatgtgttcctgggctcagaa
tggaatgcctccaacttagaggacttacagaaccgaggggtacggtatatcttgaatgtc
actcgagagatagataacttcttcccaggagtctttgagtatcataacattcgggtatat
gatgaagaggcaacggatctcctggcgtactggaatgacacttacaaattcatctctaaa
gcaaagaaacatggatctaaatgccttgtgcactgcaaaatgggggtgagtcgctcagcc
tccaccgtgattgcctatgcaatgaaggaatatggctggaatctggaccgagcctatgac
tatgtgaaagaaagacgaacggtaaccaagcccaacccaagcttcatgagacaactggaa
gagtatcaggggatcttgctggcaagcaaacagcggcataacaaactatggagatctcat
tcagatagtgacctctcagaccaccacgaacccatctgcaaacctgggctagaactcaac
aagaaggatatcaccacctcagcagaccagattgctgaggtgaagaccatggagagtcac
ccacccatacctcctgtctttgtggaacatatggtcccacaagatgcaaatcagaaaggc
ctgtgtaccaaagaaagaatgatctgcttggagtttacttctagggaatttcatgctgga
cagattgaggatgaattaaacttaaatgacatcaatggatgctcatcagggtgttgtctg
aatgaatcaaaatttcctcttgacaattgccatgcatccaaagccttaattcagcctgga
catgtcccagaaatggccaacaagtttccagacttaacagtggaagatttggagacagat
gcactgaaagcagacatgaatgtccacctactgcctatggaagaattgacatctccactg
aaagacccccccatgtcccctgatcctgagtcaccaagcccccaacccagttgccagact
gaaatctcagatttcagtacagatcgcattgacttttttagtgccctagagaagtttgtg
gagctctcccaagaaacccggtcacgatctttttcccattcaaggatggaggaactgggt
ggaggaaggaatgagagctgtcgactgtcagtggtagaagtagccccttccaaagtgaca
gctgatgaccagagaagcagctctttgagtaatactccccatgcatcagaagaatcttca
atggatgaggaacagtcaaaggcaatttcagaactggtcagcccagacatcttcatgcag
tctcactcggaaaatgcaatttcagtcaaagaaattgtcactgaaattgagtccatcagt
caaggagttgggcagattcaactgaaaggagacatcttacccaacccatgccatacacca
aagaagaacagcatccatgagctgctccttgagagggcccagactccagagaacaaacct
ggacatatggagcaagatgaggactcctgcacagcccagcctgaactagccaaagactca
gggatgtgcaacccagaaggctgcctaaccacacactcatctatagcagacttggaagaa
ggggaaccagctgagggggaacaagagctccagggctcagggatgcacccaggtgccaag
tggtaccctgggtctgtgaggcgagccaccttggagttcgaagagcgcttacggcaggag
caagagcatcatggtgctgccccaacatgtacctcattgtccactcgtaagaattcaaag
aatgattcttctgtggcagacctagcaccaaaagggaaaagtgatgaagcccccccagaa
cattcatttgtcctcaaggaaccagaaatgagcaaaggcaaagggaaatacagtgggtct
gaggctggctcactgtcccattctgagcagaatgccactgttccagctcccagggtgctg
gagtttgaccacttgccagatcctcaggagggcccagggtcagatactggaacacagcag
gaaggagtcctgaaggatctgaggactgtgattccataccaggagtctgaaacacaagca
gtccctcttccccttcccaagagggtagaaatcattgaatatacccacatagttacatca
cccaatcacactgggccagggagtgaaatagccaccagtgagaagagcggagagcaaggg
ctgaggaaagtgaacatggaaaaatctgtcactgtgctctgcacactggatgaaaatcta
aacaggactctggaccccaaccaggtttctctgcacccccaagtgctacctctgcctcat
tcttcctcccctgagcacaacagacccactgaccatccaacctccatcctgagtagccct
gaagacagaggcagcagcctgtccacagccctggagacagcagcaccttttgtcagtcat
acaacccatttactgtctgccagtttggattacctgcatccccagactatggttcacctg
gagggcttcacagagcagagcagcactacagatgagccctctgcagaacaggttagctgg
gaagaaagtcaggagagccctctctccagtggcagtgaggtgccatataaggactcccag
ctaagtagcgcagacctaagtttaattagcaaacttggtgacaacactggggagttacag
gagaaaatggacccattgcctgtagcctgtcgactcccacatagctctagtagtgaaaac
ataaagagtctcagccacagccccggtgtggtgaaggagcgtgctaaagaaatcgagtct
cgagtggttttccaggcagggctcaccaaaccatcccaaatgaggcgctcagcttctctc
gccaaattaggttacttggacctctgtaaagactgcttaccagagagggagcctgcctcc
tgtgaatcccctcatctcaaactgcttcagcctttcctcagaacagactcaggcatgcac
gcgatggaggaccaagagtccctagaaaacccaggtgccccccacaacccagagcccacc
aagtcttttgtagaacaactcacaacaacagagtgtattgtgcagagcaagccagtggag
aggccccttgtgcagtatgccaaagaatttggttctagtcagcagtatttgctccccagg
gcaggacttgaattgactagttctgaaggaggccttcccgtgctacagacccagggactg
cagtgtgcatgcccagctccagggctggccgtggcaccccgtcagcaacacggcagaact
cacccccttaggagactgaaaaaggcaaatgacaaaaaacggacaaccaaccccttctat
aataccatgtga

DBGET integrated database retrieval system