KEGG   Homo sapiens (human): 85476
Entry
85476             CDS       T01001                                 
Symbol
GFM1, COXPD1, EFG, EFG1, EFGM, EGF1, GFM, hEFG1, mtEF-G1
Name
(RefSeq) G elongation factor mitochondrial 1
  KO
K02355  elongation factor G
Organism
hsa  Homo sapiens (human)
Disease
H00891  Combined oxidative phosphorylation deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:hsa03012]
    85476 (GFM1)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    85476 (GFM1)
Translation factors [BR:hsa03012]
 Eukaryotic type
  Elongation factors
   85476 (GFM1)
 Prokaryotic type
   85476 (GFM1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    85476 (GFM1)
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    85476 (GFM1)
SSDB
Motif
Pfam: GTP_EFTU EFG_IV EFG_III EFG_C GTP_EFTU_D2 RF3_C MMR_HSR1 AvrPtoB_bdg AIG1
Other DBs
NCBI-GeneID: 85476
NCBI-ProteinID: NP_079272
OMIM: 606639
HGNC: 13780
Ensembl: ENSG00000168827
Pharos: Q96RP9(Tbio)
UniProt: Q96RP9 E5KND5
Structure
Position
3:158644527..158695581
AA seq 751 aa
MRLLGAAAVAALGRGRAPASLGWQRKQVNWKACRWSSSGVIPNEKIRNIGISAHIDSGKT
TLTERVLYYTGRIAKMHEVKGKDGVGAVMDSMELERQRGITIQSAATYTMWKDVNINIID
TPGHVDFTIEVERALRVLDGAVLVLCAVGGVQCQTMTVNRQMKRYNVPFLTFINKLDRMG
SNPARALQQMRSKLNHNAAFMQIPMGLEGNFKGIVDLIEERAIYFDGDFGQIVRYGEIPA
ELRAAATDHRQELIECVANSDEQLGEMFLEEKIPSISDLKLAIRRATLKRSFTPVFLGSA
LKNKGVQPLLDAVLEYLPNPSEVQNYAILNKEDDSKEKTKILMNSSRDNSHPFVGLAFKL
EVGRFGQLTYVRSYQGELKKGDTIYNTRTRKKVRLQRLARMHADMMEDVEEVYAGDICAL
FGIDCASGDTFTDKANSGLSMESIHVPDPVISIAMKPSNKNDLEKFSKGIGRFTREDPTF
KVYFDTENKETVISGMGELHLEIYAQRLEREYGCPCITGKPKVAFRETITAPVPFDFTHK
KQSGGAGQYGKVIGVLEPLDPEDYTKLEFSDETFGSNIPKQFVPAVEKGFLDACEKGPLS
GHKLSGLRFVLQDGAHHMVDSNEISFIRAGEGALKQALANATLCILEPIMAVEVVAPNEF
QGQVIAGINRRHGVITGQDGVEDYFTLYADVPLNDMFGYSTELRSCTEGKGEYTMEYSRY
QPCLPSTQEDVINKYLEATGQLPVKKGKAKN
NT seq 2256 nt   +upstreamnt  +downstreamnt
atgagactcctgggagctgcagccgtcgcggctctggggcgcggaagggcccccgcctcc
ctaggctggcagaggaagcaggttaattggaaggcctgccgatggtcttcatcaggggtg
attcctaatgaaaaaatacgaaatattggaatctcagctcacattgattctgggaaaact
acattaacagaacgagtcctttactacactggcagaattgcaaagatgcatgaggtgaaa
ggtaaagatggagttggtgctgtcatggattccatggaactagagagacaaagaggaatc
actattcagtcagcagccacttacaccatgtggaaagatgtcaatattaacattatagat
actcctgggcatgtggacttcacaatagaagtggaaagggccctgagagtgttggatggt
gcagtccttgttctctgtgctgttggaggggtacagtgccagaccatgactgtcaatcgt
cagatgaagcgctacaacgttccgtttctaacttttattaacaaattggaccgaatgggc
tccaacccagccagggccctgcagcaaatgaggtctaaactaaatcataatgcagcgttt
atgcagatacccatgggtttggagggtaattttaaaggtattgtagatcttattgaggaa
cgagccatctattttgatggagactttggtcagattgttcgatatggtgagattccagct
gaattaagggcggcggccactgaccaccggcaggagctaattgaatgtgttgccaattca
gatgaacagcttggtgagatgtttctggaagaaaaaatcccctcgatttctgatttaaag
ctagcaattcgaagagctactctgaaaagatcatttactcctgtatttttgggaagcgcc
ttgaagaacaaaggagttcagcctcttttagatgctgttttagaatacctcccaaatcca
tctgaagtccagaactatgctattctcaataaagaggatgactcaaaagagaaaaccaaa
atcctaatgaactccagtagagacaattcccacccatttgtaggcctggcttttaaactg
gaggtaggtcgatttggacaattaacttatgttcgcagttatcagggagagctaaagaag
ggtgacaccatctataacacaaggacaagaaagaaagtacggttgcaacggctggctcgc
atgcatgccgacatgatggaggatgttgaggaagtatatgccggagacatctgtgcattg
tttggcattgactgtgctagtggagacacattcacagacaaagccaacagcggcctttct
atggagtcaattcatgttcctgatcctgtcatttcaatagcaatgaagccttctaacaag
aacgatctggaaaaattttcaaaaggtattggcaggtttacaagagaagatcccacattt
aaagtatactttgacactgagaacaaagagacagttatatctggaatgggagaattacac
ctggaaatctatgctcagaggctggaaagagagtatggctgtccttgtatcacaggaaag
ccaaaagttgcctttcgagagaccattactgcccctgtcccgtttgactttacacataaa
aaacaatcaggtggtgcaggccagtatggaaaagtaataggtgtcctggagcctctggac
ccagaggactacactaaattggaattttcagatgaaacattcggatcaaatattccaaag
cagtttgtgcctgctgtagaaaaggggtttttagatgcctgcgagaagggccctctttct
ggtcacaagctctctgggctccggtttgtcctgcaagatggagcacaccacatggttgat
tctaatgaaatctctttcatccgagcaggagaaggtgctcttaaacaagccttggcaaat
gcaacattatgtattcttgaacctattatggctgtggaagttgtagctccaaatgaattt
cagggacaagtaattgcaggaattaaccgacgccatggggtaatcactgggcaagatgga
gttgaggactattttacactgtatgcagatgtccctctaaatgatatgtttggttattcc
actgaacttaggtcatgcacagagggaaagggagaatacacaatggagtatagcaggtat
cagccatgtttaccatccacacaagaagacgtcattaataagtatttggaagctacaggt
caacttcctgttaaaaaaggaaaagccaagaactaa

DBGET integrated database retrieval system