KEGG   Homo sapiens (human): 85477Help
Entry
85477             CDS       T01001                                 

Gene name
SCIN
Definition
(RefSeq) scinderin
  KO
K05768  gelsolin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa04810  Regulation of actin cytoskeleton
hsa05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    85477 (SCIN)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    85477 (SCIN)
 09160 Human Diseases
  09161 Cancers: Overview
   05203 Viral carcinogenesis
    85477 (SCIN)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    85477 (SCIN)
   04147 Exosome [BR:hsa04147]
    85477 (SCIN)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Gelsolin / villin
     85477 (SCIN)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   85477 (SCIN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gelsolin
Motif
Other DBs
NCBI-GeneID: 85477
NCBI-ProteinID: NP_001106177
OMIM: 613416
HGNC: 21695
Ensembl: ENSG00000006747
Vega: OTTHUMG00000152385
Pharos: Q9Y6U3(Tbio)
UniProt: Q9Y6U3
Structure
PDB: 

Position
7p21.3
AA seq 715 aa AA seqDB search
MARELYHEEFARAGKQAGLQVWRIEKLELVPVPQSAHGDFYVGDAYLVLHTAKTSRGFTY
HLHFWLGKECSQDESTAAAIFTVQMDDYLGGKPVQNRELQGYESNDFVSYFKGGLKYKAG
GVASGLNHVLTNDLTAKRLLHVKGRRVVRATEVPLSWDSFNKGDCFIIDLGTEIYQWCGS
SCNKYERLKANQVATGIRYNERKGRSELIVVEEGSEPSELIKVLGEKPELPDGGDDDDII
ADISNRKMAKLYMVSDASGSMRVTVVAEENPFSMAMLLSEECFILDHGAAKQIFVWKGKD
ANPQERKAAMKTAEEFLQQMNYSKNTQIQVLPEGGETPIFKQFFKDWRDKDQSDGFGKVY
VTEKVAQIKQIPFDASKLHSSPQMAAQHNMVDDGSGKVEIWRVENNGRIQVDQNSYGEFY
GGDCYIILYTYPRGQIIYTWQGANATRDELTTSAFLTVQLDRSLGGQAVQIRVSQGKEPV
HLLSLFKDKPLIIYKNGTSKKGGQAPAPPTRLFQVRRNLASITRIVEVDVDANSLNSNDV
FVLKLPQNSGYIWVGKGASQEEEKGAEYVASVLKCKTLRIQEGEEPEEFWNSLGGKKDYQ
TSPLLETQAEDHPPRLYGCSNKTGRFVIEEIPGEFTQDDLAEDDVMLLDAWEQIFIWIGK
DANEVEKKESLKSAKMYLETDPSGRDKRTPIVIIKQGHEPPTFTGWFLGWDSSKW
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgggagctataccacgaagagttcgcccgggcgggcaagcaggcggggctgcag
gtctggaggattgagaagctggagctggtgcccgtgccccagagcgctcacggcgacttc
tacgtcggggatgcctacctggtgctgcacacggccaagacgagccgaggcttcacctac
cacctgcacttctggctcggaaaggagtgttcccaggatgaaagcacagctgctgccatc
ttcactgttcagatggatgactatttgggtggcaagccagtgcagaatagagaacttcaa
ggatatgagtctaatgactttgttagctatttcaaaggcggtctgaaatacaaggctgga
ggcgtggcatctggattaaatcatgttcttacgaacgacctgacagccaagaggctccta
catgtgaagggtcgtagagtggtgagagccacagaagttccccttagctgggacagtttc
aacaagggtgactgcttcatcattgaccttggcaccgaaatttatcagtggtgtggttcc
tcgtgcaacaaatatgaacgtctgaaggcaaaccaggtagctactggcattcggtacaat
gaaaggaaaggaaggtctgaactaattgtcgtggaagaaggaagtgaaccctcagaactt
ataaaggtcttaggggaaaagccagagcttccagatggaggtgatgatgatgacattata
gcagacataagtaacaggaaaatggctaaactatacatggtttcagatgcaagtggctcc
atgagagtgactgtggtggcagaagaaaaccccttctcaatggcaatgctgctgtctgaa
gaatgctttattttggaccacggggctgccaaacaaattttcgtatggaaaggtaaagat
gctaatccccaagagaggaaggctgcaatgaagacagctgaagaatttctacagcaaatg
aattattccaagaatacccaaattcaagttcttccagaaggaggtgaaacaccaatcttc
aaacagttttttaaggactggagagataaagatcagagtgatggcttcgggaaagtttat
gtcacagagaaagtggctcaaataaaacaaattccctttgatgcctcaaaattacacagt
tctccgcagatggcagcccagcacaatatggtggatgatggttctggcaaagtggagatt
tggcgtgtagaaaacaatggtaggatccaagttgaccaaaactcatatggtgaattctat
ggtggtgactgctacatcatactctacacctatcccagaggacagattatctacacgtgg
caaggagcaaatgccacacgagatgagctgacaacatctgcgttcctgactgttcagttg
gatcggtcccttggaggacaggctgtgcagatccgagtctcccaaggcaaagagcctgtt
cacctactgagtttgttcaaagacaaaccgctcattatttacaagaatggaacatcaaag
aaaggaggtcaggcacctgctccccctacacgcctctttcaagtccggagaaacctggca
tctatcaccagaattgtggaggttgatgttgatgcaaattcactgaattctaacgatgtt
tttgtcctgaaactgccacaaaatagtggctacatctgggtaggaaaaggtgctagccag
gaggaggagaaaggagcagagtatgtagcaagtgtcctaaagtgcaaaaccttaaggatc
caagaaggcgaggagccagaggagttctggaattcccttggagggaaaaaagactaccag
acctcaccactactggaaacccaggctgaagaccatccacctcggctttacggctgctct
aacaaaactggaagatttgttattgaagagattccaggagagttcacccaggatgattta
gctgaagatgatgtcatgttactagatgcttgggaacagatatttatttggattggcaaa
gatgctaatgaagttgagaaaaaagaatctctgaagtctgccaaaatgtaccttgagaca
gacccttctggaagagacaagaggacaccaattgtcatcataaaacagggccatgagcca
cccacattcacaggctggttcctgggctgggattccagcaagtggtaa

DBGET integrated database retrieval system