KEGG   Homo sapiens (human): 85478
Entry
85478             CDS       T01001                                 
Symbol
CCDC65, CFAP250, DRC2, FAP250, NYD-SP28
Name
(RefSeq) coiled-coil domain containing 65
  KO
K23728  dynein regulatory complex subunit 2
Organism
hsa  Homo sapiens (human)
Disease
H00564  Primary ciliary dyskinesia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:hsa03037]
    85478 (CCDC65)
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    85478 (CCDC65)
Cilium and associated proteins [BR:hsa03037]
 Motile cilia and associated proteins
  Nexin-dynein regulatory complex
   85478 (CCDC65)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 Other domain-containing proteins
  Others
   85478 (CCDC65)
SSDB
Motif
Pfam: NYD-SP28
Other DBs
NCBI-GeneID: 85478
NCBI-ProteinID: NP_149115
OMIM: 611088
HGNC: 29937
Ensembl: ENSG00000139537
Pharos: Q8IXS2(Tdark)
UniProt: Q8IXS2
Position
12:48904133..48921576
AA seq 484 aa
MPKKEKMAKTPLSDEKQLLLFQQKLLAEEEMAKKKERLLSQFLKDKLAKEEHNSALNLNK
INTQWRTVLREVKTRELHKDIEILSQTFERVVDCKDNVIKSLAKDLSEAEEQYAHALRSH
LHNVDQLLALQRHRLSLLEESYNMELEALTKEFETERKTIIDQHEKEIHYLQDIFMAMEQ
NYIDSEYESKLEFQSMWNDLKNMNLEEKHFLRLHLENRVEDLWRKFQDVLKNYTDATEDR
KAAFETLQVKDEKSSKEIEVQMKKIQKLQDAITISKGKIMIHSRESEDENRYIRNDKELV
LVQLRKLKAQRTQARAASQKNLVRLTLESNATLKALRKIVDKGEKILKLAEICRKFETEE
EKVLPFYSSVLTPKEQEGIQKNNLEELTEELTKVMVDYIGMENFWKRYNKVKLEQLSLQH
RRAQLLDINGKLREMLKQYLDGISVSDEVLSQLNPLFIVNYQSNLLQPLSIRIAHPGDKQ
HPTT
NT seq 1455 nt   +upstreamnt  +downstreamnt
atgcctaagaaagaaaaaatggccaagacgcccctgtccgatgagaagcagctgcttctg
tttcagcagaagttgctggcagaggaggagatggccaaaaagaaggagaggctcctcagc
cagttcttgaaggacaagctggccaaggaggaacacaacagtgctctgaaccttaataag
attaacacacagtggagaactgtccttcgggaagtcaagaccagagaacttcataaggac
attgagatcctcagccaaacatttgaacgagtggtggactgtaaggacaatgtcatcaag
tctttagctaaagacctgtccgaagccgaggagcagtacgcccatgccctgcgcagccac
ttgcacaatgttgaccagctcttggccctgcagaggcaccggctcagtctcctggaggaa
agttacaacatggagctggaagccctaaccaaggagtttgagacagaaaggaagacaatt
attgaccaacatgagaaagagattcactatctgcaagatatcttcatggccatggagcag
aactatatagattctgagtatgaaagcaagctggagttccagagcatgtggaatgatctc
aaaaacatgaatttagaagagaagcactttctaagactgcacctggagaacagagtagaa
gatctgtggagaaagttccaggatgtactcaagaattacactgatgccacagaggatcga
aaggctgcctttgagaccctgcaggtgaaggatgagaagagctccaaagagattgaagta
cagatgaaaaaaatacagaaactacaggatgccataactatttcaaaaggcaagatcatg
atacacagccgtgagagtgaagatgagaaccggtatatccgtaatgacaaggaattggtc
cttgtacaactgcgaaaacttaaggcccaaagaactcaggcccgggcagcatcccagaag
aacttagtcagactcaccctggaaagtaatgccaccctcaaggccctgagaaagattgtt
gataagggtgaaaagatccttaaacttgctgaaatatgtaggaaatttgaaaccgaagaa
gaaaaagtgctgcctttttattcatcagtattgactcctaaggagcaggaggggattcag
aagaataatctagaagagcttactgaggagctcaccaaggtgatggtggactacatagga
atggagaatttctggaaaaggtacaacaaagtgaaactggagcaactgagcctccaacat
agacgagcccagctgctagatatcaatgggaagctgcgggagatgctgaagcagtacttg
gatggcatctcagtgagtgacgaagtgctgagccagctcaacccactctttatagtcaac
tatcaaagcaacttactccagcccttgtccatacgtatagcccatccaggtgataaacaa
catccaaccacttaa

DBGET integrated database retrieval system