KEGG   Homo sapiens (human): 8550Help
Entry
8550              CDS       T01001                                 

Gene name
MAPKAPK5, MAPKAP-K5, MK-5, MK5, PRAK
Definition
(RefSeq) mitogen-activated protein kinase-activated protein kinase 5
  KO
K04442  mitogen-activated protein kinase-activated protein kinase 5 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    8550 (MAPKAPK5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    8550 (MAPKAPK5)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     8550 (MAPKAPK5)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   8550 (MAPKAPK5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like
Motif
Other DBs
NCBI-GeneID: 8550
NCBI-ProteinID: NP_620777
OMIM: 606723
HGNC: 6889
Ensembl: ENSG00000089022
Vega: OTTHUMG00000169605
Pharos: Q8IW41(Tchem)
UniProt: Q8IW41
Position
12q24.12-q24.13
AA seq 473 aa AA seqDB search
MSEESDMDKAIKETSILEEYSINWTQKLGAGISGPVRVCVKKSTQERFALKILLDRPKAR
NEVRLHMMCATHPNIVQIIEVFANSVQFPHESSPRARLLIVMEMMEGGELFHRISQHRHF
TEKQASQVTKQIALALRHCHLLNIAHRDLKPENLLFKDNSLDAPVKLCDFGFAKIDQGDL
MTPQFTPYYVAPQVLEAQRRHQKEKSGIIPTSPTPYTYNKSCDLWSLGVIIYVMLCGYPP
FYSKHHSRTIPKDMRRKIMTGSFEFPEEEWSQISEMAKDVVRKLLKVKPEERLTIEGVLD
HPWLNSTEALDNVLPSAQLMMDKAVVAGIQQAHAEQLANMRIQDLKVSLKPLHSVNNPIL
RKRKLLGTKPKDSVYIHDHENGAEDSNVALEKLRDVIAQCILPQAGKGENEDEKLNEVMQ
EAWKYNRECKLLRDTLQSFSWNGRGFTDKVDRLKLAEIVKQVIEEQTTSHESQ
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaggagagcgacatggacaaagccatcaaggaaacttccattttagaagaatac
agtatcaattggactcagaagctgggagctggaattagtggtccagttagagtctgtgta
aagaaatctactcaagaacggtttgcgctgaaaattcttcttgatcgtccaaaagctaga
aatgaggtacgtctgcacatgatgtgtgccacacacccaaacatagttcagattattgaa
gtgtttgctaacagtgtccagtttccccatgagtccagccctagggcccgactcttaatt
gtaatggagatgatggaagggggagagctatttcacagaatcagccagcaccggcacttt
acagagaagcaagccagccaagtaacaaagcagatagctttggctctgcggcactgtcac
ttgttaaacattgcgcacagagacctcaagcctgaaaatctgctttttaaggataactct
ttggatgccccagtgaagttgtgtgactttggatttgccaagattgaccaaggtgacttg
atgacaccccagttcaccccttattatgtagcaccccaggtactggaggcgcaaagaagg
catcagaaggagaaatctggcatcatacctacctcaccgacgccctacacttacaacaag
agctgtgacttgtggtccctaggggtgattatctatgtgatgctgtgcggataccctcct
ttttactccaaacaccacagccggactatcccaaaggatatgcgaagaaagatcatgaca
ggcagttttgagttcccagaggaagagtggagtcagatctcagagatggccaaagatgtt
gtgaggaagctcctgaaggtcaaaccggaggagagactcaccatcgagggagtgctggac
cacccctggctcaattccaccgaggccctggataatgtgctgccttctgctcagctgatg
atggacaaggcagtggttgcaggaatccagcaggctcacgcggaacagttggccaacatg
agaatccaggatctgaaagtcagcctcaaacccctgcactcagtgaacaaccccattctg
cggaagaggaagttacttggcaccaagccaaaggacagtgtctatatccacgaccatgag
aatggagccgaggattccaatgttgccttggaaaaactccgagatgtgattgctcagtgt
attctcccccaggctggtaaaggagagaatgaagatgagaaactgaatgaagtaatgcag
gaggcttggaagtataaccgggaatgcaaactcctaagagatactctgcagagcttcagc
tggaatggtcgtggattcacagataaagtagatcgactaaaactggcagaaattgtgaag
caggtgatagaagagcaaaccacgtcccacgaatcccaataa

DBGET integrated database retrieval system