KEGG   Homo sapiens (human): 8562Help
Entry
8562              CDS       T01001                                 

Gene name
DENR, DRP, DRP1, SMAP-3
Definition
(RefSeq) density regulated re-initiation and release factor
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: SUI1
Motif
Other DBs
NCBI-GeneID: 8562
NCBI-ProteinID: NP_003668
OMIM: 604550
HGNC: 2769
Ensembl: ENSG00000139726
Vega: OTTHUMG00000168844
Pharos: O43583(Tbio)
UniProt: O43583 A0A024RBR3
Structure
PDB: 

Position
12q24.31
AA seq 198 aa AA seqDB search
MAADISESSGADCKGDPRNSAKLDADYPLRVLYCGVCSLPTEYCEYMPDVAKCRQWLEKN
FPNEFAKLTVENSPKQEAGISEGQGTAGEEEEKKKQKRGGRGQIKQKKKTVPQKVTIAKI
PRAKKKYVTRVCGLATFEIDLKEAQRFFAQKFSCGASVTGEDEIIIQGDFTDDIIDVIQE
KWPEVDDDSIEDLGEVKK
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggctgctgacatttctgaatccagcggggctgactgcaaaggagacccaaggaacagt
gccaagttagatgccgattacccacttcgagtcctttattgtggagtctgttcattacca
acagagtactgtgaatatatgcctgatgttgctaaatgtagacaatggttagagaagaat
tttccaaatgaatttgcaaaacttactgtagaaaattcacccaaacaagaagctggaatt
agtgagggtcaaggaacagcaggggaagaagaggagaagaaaaaacagaagagaggtgga
aggggtcaaataaaacaaaaaaagaagaccgtaccacaaaaggttactatagccaaaatt
cccagagcaaagaagaaatatgtgacaagagtatgtggccttgcaacttttgaaattgat
cttaaagaagcacaaagattttttgctcaaaaattctcctgtggtgcctcagtaacaggg
gaggatgaaattatcattcagggagattttacagatgacataattgatgtcattcaggaa
aaatggccagaggtagatgatgacagcatcgaagatcttggagaagtaaagaagtga

DBGET integrated database retrieval system