KEGG   Homo sapiens (human): 8566Help
Entry
8566              CDS       T01001                                 

Gene name
PDXK, C21orf124, C21orf97, HEL-S-1a, PKH, PNK, PRED79
Definition
(RefSeq) pyridoxal kinase
  KO
K00868  pyridoxine kinase [EC:2.7.1.35]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00750  Vitamin B6 metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    8566 (PDXK)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.35  pyridoxal kinase
     8566 (PDXK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phos_pyr_kin PfkB HpcH_HpaI Staphylokinase
Motif
Other DBs
NCBI-GeneID: 8566
NCBI-ProteinID: NP_003672
OMIM: 179020
HGNC: 8819
Ensembl: ENSG00000160209
Vega: OTTHUMG00000086870
Pharos: O00764(Tbio)
UniProt: O00764 V9HWC3
Structure
PDB: 

Position
21q22.3
AA seq 312 aa AA seqDB search
MEEECRVLSIQSHVIRGYVGNRAATFPLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSD
ELQELYEGLRLNNMNKYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKW
DGEGSMYVPEDLLPVYKEKVVPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLHSMGP
DTVVITSSDLPSPQGSNYLIVLGSQRRRNPAGSVVMERIRMDIRKVDAVFVGTGDLFAAM
LLAWTHKHPNNLKVACEKTVSTLHHVLQRTIQCAKAQAGEGVRPSPMQLELRMVQSKRDI
EDPEIVVQATVL
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggaggaggagtgccgggtgctctccatacagagccacgtcatccgcggctacgtgggc
aaccgggcggccacgttcccgctgcaggttttgggatttgagattgacgcggtgaactct
gtccagttttcaaaccacacaggctatgcccactggaagggccaagtgctgaattcagat
gagctccaggagttgtacgaaggcctgaggctgaacaacatgaataaatatgactacgtg
ctcacaggttatacgagggacaagtcgttcctggccatggtggtggacattgtgcaggag
ctgaagcagcagaaccccaggctggtgtacgtgtgtgatccagtcttgggtgacaagtgg
gacggcgaaggctcgatgtacgtcccggaggacctccttcccgtctacaaagaaaaagtg
gtgccgcttgcagacattatcacgcccaaccagtttgaggccgagttactgagtggccgg
aagatccacagccaggaggaagccttgcgggtgatggacatgctgcactctatgggcccc
gacaccgtggtcatcaccagctccgacctgccctccccgcagggcagcaactacctgatt
gtgctggggagtcagaggaggaggaatcccgctggctccgtggtgatggaacgcatccgg
atggacattcgcaaagtggacgccgtctttgtgggcactggggacctgtttgctgccatg
ctcctggcgtggacacacaagcaccccaataacctcaaggtggcctgtgagaagaccgtg
tctaccttgcaccacgttctgcagaggaccatccagtgtgcaaaagcccaggccggggaa
ggagtgaggcccagccccatgcagctggagctgcggatggtgcagagcaaaagggacatc
gaggacccagagatcgtcgtccaggccacggtgctgtga

DBGET integrated database retrieval system