KEGG   Homo sapiens (human): 8567Help
Entry
8567              CDS       T01001                                 

Gene name
MADD, DENN, IG20, RAB3GEP
Definition
(RefSeq) MAP kinase activating death domain
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: DENN uDENN HD-ZIP_N
Motif
Other DBs
NCBI-GeneID: 8567
NCBI-ProteinID: NP_003673
OMIM: 603584
HGNC: 6766
Ensembl: ENSG00000110514
Vega: OTTHUMG00000150350
Pharos: Q8WXG6(Tbio)
UniProt: Q8WXG6
Position
11p11.2
AA seq 1647 aa AA seqDB search
MVQKKKFCPRLLDYLVIVGARHPSSDSVAQTPELLRRYPLEDHTEFPLPPDVVFFCQPEG
CLSVRQRRMSLRDDTSFVFTLTDKDTGVTRYGICVNFYRSFQKRISKEKGEGGAGSRGKE
GTHATCASEEGGTESSESGSSLQPLSADSTPDVNQSPRGKRRAKAGSRSRNSTLTSLCVL
SHYPFFSTFRECLYTLKRLVDCCSERLLGKKLGIPRGVQRDTMWRIFTGSLLVEEKSSAL
LHDLREIEAWIYRLLRSPVPVSGQKRVDIEVLPQELQPALTFALPDPSRFTLVDFPLHLP
LELLGVDACLQVLTCILLEHKVVLQSRDYNALSMSVMAFVAMIYPLEYMFPVIPLLPTCM
ASAEQLLLAPTPYIIGVPASFFLYKLDFKMPDDVWLVDLDSNRVIAPTNAEVLPILPEPE
SLELKKHLKQALASMSLNTQPILNLEKFHEGQEIPLLLGRPSNDLQSTPSTEFNPLIYGN
DVDSVDVATRVAMVRFFNSANVLQGFQMHTRTLRLFPRPVVAFQAGSFLASRPRQTPFAE
KLARTQAVEYFGEWILNPTNYAFQRIHNNMFDPALIGDKPKWYAHQLQPIHYRVYDSNSQ
LAEALSVPPERDSDSEPTDDSGSDSMDYDDSSSSYSSLGDFVSEMMKCDINGDTPNVDPL
THAALGDASEVEIDELQNQKEAEEPGPDSENSQENPPLRSSSSTTASSSPSTVIHGANSE
PADSTEMDDKAAVGVSKPLPSVPPSIGKSNVDRRQAEIGEGSVRRRIYDNPYFEPQYGFP
PEEDEDEQGESYTPRFSQHVSGNRAQKLLRPNSLRLASDSDAESDSRASSPNSTVSNTST
EGFGGIMSFASSLYRNHSTSFSLSNLTLPTKGAREKATPFPSLKVFGLNTLMEIVTEAGP
GSGEGNRRALVDQKSSVIKHSPTVKREPPSPQGRSSNSSENQQFLKEVVHSVLDGQGVGW
LNMKKVRRLLESEQLRVFVLSKLNRMVQSEDDARQDIIPDVEISRKVYKGMLDLLKCTVL
SLEQSYAHAGLGGMASIFGLLEIAQTHYYSKEPDKRKRSPTESVNTPVGKDPGLAGRGDP
KAMAQLRVPQLGPRAPSATGKGPKELDTRSLKEENFIASIELWNKHQEVKKQKALEKQRP
EVIKPVFDLGETEEKKSQISADSGVSLTSSSQRTDQDSVIGVSPAVMIRSSSQDSEVSTV
VSNSSGETLGADSDLSSNAGDGPGGEGSVHLASSRGTLSDSEIETNSATSTIFGKAHSLK
PSIKEKLAGSPIRTSEDVSQRVYLYEGLLGRDKGSMWDQLEDAAMETFSISKERSTLWDQ
MQFWEDAFLDAVMLEREGMGMDQGPQEMIDRYLSLGEHDRKRLEDDEDRLLATLLHNLIS
YMLLMKVNKNDIRKKVRRLMGKSHIGLVYSQQINEVLDQLANLNGRDLSIWSSGSRHMKK
QTFVVHAGTDTNGDIFFMEVCDDCVVLRSNIGTVYERWWYEKLINMTYCPKTKVLCLWRR
NGSETQLNKFYTKKCRELYYCVKDSMERAAARQQSIKPGPELGGEFPVQDLKTGEGGLLQ
VTLEGINLKFMHNQVFIELNHIKKCNTVRGVFVLEEFVPEIKEVVSHKYKTPMAHEICYS
VLCLFSYVAAVHSSEEDLRTPPRPVSS
NT seq 4944 nt NT seq  +upstreamnt  +downstreamnt
atggtgcaaaagaagaagttctgtcctcggttacttgactatctagtgatcgtaggggcc
aggcacccgagcagtgatagcgtggcccagactcctgaattgctacggcgataccccttg
gaggatcacactgagtttcccctgcccccagatgtagtgttcttctgccagcccgagggc
tgcctgagcgtgcggcagcggcgcatgagccttcgggatgatacctcttttgtcttcacc
ctcactgacaaggacactggagtcacgcgatatggcatctgtgttaacttctaccgctcc
ttccaaaagcgaatctctaaggagaagggggaaggtggggcagggtcccgtgggaaggaa
ggaacccatgccacctgtgcctcagaagagggtggcactgagagctcagagagtggctca
tccctgcagcctctcagtgctgactctacccctgatgtgaaccagtctcctcggggcaaa
cgccgggccaaggcggggagccgctcccgcaacagtactctcacgtccctgtgcgtgctc
agccactaccctttcttctccaccttccgagagtgtttgtatactctcaagcgcctggtg
gactgctgtagtgagcgccttctgggcaagaaactgggcatccctcgaggcgtacaaagg
gacaccatgtggcggatctttactggatcgctgctggtagaggagaagtcaagtgccctt
ctgcatgaccttcgagagattgaggcctggatctatcgattgctgcgctccccagtaccc
gtctctgggcagaagcgagtagacatcgaggtcctaccccaagagctccagccagctctg
acctttgctcttccagacccatctcgattcaccctagtggatttcccactgcaccttccc
ttggaacttctaggtgtggacgcctgtctccaggtgctaacctgcattctgttagagcac
aaggtggtgctacagtcccgagactacaatgcactctccatgtctgtgatggcattcgtg
gcaatgatctacccactggagtatatgtttcctgtcatcccgctgctacccacctgcatg
gcatcagcagagcagctgctgttggctccaaccccgtacatcattggggttcctgccagc
ttcttcctctacaaactggacttcaaaatgcctgatgatgtatggctagtggatctggac
agcaatagggtgattgcccccaccaatgcagaagtgctgcctatcctgccagaaccagaa
tcactagagctgaaaaagcatttaaagcaggccttggccagcatgagtctcaacacccag
cccatcctcaatctggagaaatttcatgagggccaggagatcccccttctcttgggaagg
ccttctaatgacctgcagtccacaccgtccactgaattcaacccactcatctatggcaat
gatgtggattctgtggatgttgcaaccagggttgccatggtacggttcttcaattccgcc
aacgtgctgcagggatttcagatgcacacgcgtaccctgcgcctctttcctcggcctgtg
gtagcttttcaagctggctcctttctagcctcacgtccccggcagactccttttgccgag
aaattggccaggactcaggctgtggagtactttggggaatggatccttaaccccaccaac
tatgcctttcagcgaattcacaacaatatgtttgatccagccctgattggtgacaagcca
aagtggtatgctcatcagctgcagcctatccactatcgcgtctatgacagcaattcccag
ctggctgaggccctgagtgtaccaccagagcgggactctgactccgaacctactgatgat
agtggcagtgatagtatggattatgacgattcaagctcttcttactcctcccttggtgac
tttgtcagtgaaatgatgaaatgtgacattaatggtgatactcccaatgtggaccctctg
acacatgcagcactgggggatgccagcgaggtggagattgacgagctgcagaatcagaag
gaagcagaagagcctggcccagacagtgagaactctcaggaaaaccccccactgcgctcc
agctctagcaccacagccagcagcagccccagcactgtcatccacggagccaactctgaa
cctgctgactctacggagatggatgataaggcagcagtaggcgtctccaagcccctccct
tccgtgcctcccagcattggcaaatcgaacgtggacagacgtcaggcagaaattggagag
gggtcagtgcgccggcgaatctatgacaatccatacttcgagccccaatatggctttccc
cctgaggaagatgaggatgagcagggggaaagttacactccccgattcagccaacatgtc
agtggcaatcgggctcaaaagctgctgcggcccaacagcttgagactggcaagtgactca
gatgcagagtcagactctcgggcaagctctcccaactccaccgtctccaacaccagcacc
gagggcttcgggggcatcatgtcttttgccagcagcctctatcggaaccacagtaccagc
ttcagtctttcaaacctcacactgcccaccaaaggtgcccgagagaaggccacgcccttc
cccagtctgaaagtatttgggctaaatactctaatggagattgttactgaagccggcccc
gggagtggtgaaggaaacaggagggcgttagtggatcagaagtcatctgtcattaaacac
agcccaacagtgaaaagagaacctccatcaccccagggtcgatccagcaattctagtgag
aaccagcagttcctgaaggaggtggtgcacagcgtgctggacggccagggagttggctgg
ctcaacatgaaaaaggtgcgccggctgctggagagcgagcagctgcgagtctttgtcctg
agcaagctgaaccgcatggtgcagtcagaggacgatgcccggcaggacatcatcccggat
gtggagatcagtcggaaggtgtacaagggaatgttagacctcctcaagtgtacagtcctc
agcttggagcagtcctatgcccacgcgggtctgggtggcatggccagcatctttgggctt
ttggagattgcccagacccactactatagtaaagaaccagacaagcggaagagaagtcca
acagaaagtgtaaataccccagttggcaaggatcctggcctagctgggcggggggaccca
aaggctatggcacaactgagagttccacaactgggacctcgggcaccaagtgccacagga
aagggtcctaaggaactggacaccagaagtttaaaggaagaaaattttatagcatctatt
gaattgtggaacaagcaccaggaagtgaaaaagcaaaaagctttggaaaaacagaggcct
gaagtaatcaaacctgtctttgaccttggtgagacagaggagaaaaagtcccagatcagc
gcagacagtggtgtgagcctgacgtctagttcccagaggactgatcaagactctgtcatc
ggcgtgagtccagctgttatgatccgcagctcaagtcaggattctgaagttagcaccgtg
gtgagtaatagctctggagagacccttggagctgacagtgacttgagcagcaatgcaggt
gatggaccaggtggcgagggcagtgttcacctggcaagctctcggggcactttgtctgat
agtgaaattgagaccaactctgccacaagcaccatctttggtaaagcccacagcttgaag
ccaagcataaaggagaagctggcaggcagccccattcgtacttctgaagatgtgagccag
cgagtctatctctatgagggactcctaggaagggacaaaggatccatgtgggaccagtta
gaggatgcagctatggagaccttttctataagcaaagagcgttctactttatgggaccaa
atgcaattctgggaagatgccttcttagatgctgtgatgttggagagagaagggatgggt
atggaccagggtccccaggaaatgatcgacaggtacctgtcccttggagaacatgaccgg
aagcgcctggaagatgatgaagatcgcttgctggccacacttctgcacaacctcatctcc
tacatgctgctgatgaaggtaaataagaatgacatccgcaagaaggtgaggcgcctaatg
ggaaagtcgcacattgggcttgtgtacagccagcaaatcaatgaggtgcttgatcagctg
gcgaacctgaatggacgcgatctctctatctggtccagtggcagccggcacatgaagaag
cagacatttgtggtacatgcagggacagatacaaacggagatatctttttcatggaggtg
tgcgatgactgtgtggtgttgcgtagtaacatcggaacagtgtatgagcgctggtggtac
gagaagctcatcaacatgacctactgtcccaagacgaaggtgttgtgcttgtggcgtaga
aatggctctgagacccagctcaacaagttctatactaaaaagtgtcgggagctgtactac
tgtgtgaaggacagcatggagcgcgctgccgcccgacagcaaagcatcaaacccggacct
gaattgggtggcgagttccctgtgcaggacctgaagactggtgagggtggcctgctgcag
gtgaccctggaagggatcaacctcaaattcatgcacaatcaggttttcatagagctgaat
cacattaaaaagtgcaatacagttcgaggcgtctttgtcctggaggaatttgttcctgaa
attaaagaagtggtgagccacaagtacaagacaccaatggcccacgaaatctgctactcc
gtattatgtctcttctcgtacgtggctgcagttcatagcagtgaggaagatctcagaacc
ccgccccggcctgtctctagctga

DBGET integrated database retrieval system