KEGG   Homo sapiens (human): 8568
Entry
8568              CDS       T01001                                 

Gene name
RRP1, D21S2056E, NNP-1, NOP52, RRP1A
Definition
(RefSeq) ribosomal RNA processing 1
  KO
K14849  ribosomal RNA-processing protein 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    8568 (RRP1)
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:hsa03009]
    8568 (RRP1)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     8568 (RRP1)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic type
  Pre-60S particles
   Other pre-60S particles
    8568 (RRP1)
SSDB
Motif
Pfam: Nop52 CNOT1_HEAT_N Tn7_Tnp_TnsA_C
Other DBs
NCBI-GeneID: 8568
NCBI-ProteinID: NP_003674
OMIM: 610653
HGNC: 18785
Ensembl: ENSG00000160214
Vega: OTTHUMG00000086884
Pharos: P56182(Tbio)
UniProt: P56182
Position
21q22.3
AA seq 461 aa
MVSRVQLPPEIQLAQRLAGNEQVTRDRAVRKLRKYIVARTQRAAGGFTHDELLKVWKGLF
YCMWMQDKPLLQEELGRTISQLVHAFQTTEAQHLFLQAFWQTMNREWTGIDRLRLDKFYM
LMRMVLNESLKVLKMQGWEERQIEELLELLMTEILHPSSQAPNGVKSHFIEIFLEELTKV
GAEELTADQNLKFIDPFCRIAARTKDSLVLNNITRGIFETIVEQAPLAIEDLLNELDTQD
EEVASDSDESSEGGERGDALSQKRSEKPPAGSICRAEPEAGEEQAGDDRDSGGPVLQFDY
EAVANRLFEMASRQSTPSQNRKRLYKVIRKLQDLAGGIFPEDEIPEKACRRLLEGRRQKK
TKKQKRLLRLQQERGKGEKEPPSPGMERKRSRRRGVGADPEARAEAGEQPGTAERALLRD
QPRGRGQRGARQRRRTPRPLTSARAKAANVQEPEKKKKRRE
NT seq 1386 nt   +upstreamnt  +downstreamnt
atggtttcgcgcgtgcagctcccgcctgagatccagctggctcagcgcctggcggggaat
gagcaggtgacccgggaccgggcggtgaggaagctccggaaatacatcgtcgccaggact
cagcgggccgcaggtggttttacgcacgacgagctgctgaaggtgtggaaaggactgttt
tattgcatgtggatgcaggacaagccactcctccaggaagaattaggaaggactatttcc
cagctcgttcatgcttttcagaccacggaggcgcagcacctgttccttcaggccttctgg
cagaccatgaatcgcgagtggacgggcattgacaggctgcgcctggataaattctacatg
ctcatgcggatggtcctgaacgagtccttgaaggttctgaagatgcaaggctgggaagaa
agacagatcgaggagctgctagagctgctgatgactgagatcctgcaccccagcagccag
gcccccaacggtgtgaagagccacttcatcgagatcttcctggaggagctgaccaaagtg
ggcgccgaggagcttacggcagaccagaacctgaagttcatcgaccccttctgcagaatt
gctgcccggaccaaggattccttggttttgaacaacatcactcgaggcatctttgagacg
attgtggagcaggccccgcttgccattgaagacctcctgaatgaactggacacacaggat
gaggaggtggcgtcggacagtgatgagtcctctgagggtggtgagcgtggagacgcgctg
tcccagaagaggtctgagaagccgcccgcaggctccatctgcagggctgaacctgaggct
ggtgaggagcaggcaggtgacgacagggacagtggcggccccgttctccagtttgactac
gaggcagttgctaacagactgtttgaaatggccagccgccagagcaccccttctcagaac
agaaagcgtctctacaaagtgatccggaagctgcaggacctggcaggaggcattttccct
gaagatgagatcccagagaaggcctgcaggcgcctgcttgaagggaggcggcagaagaag
acgaagaagcagaagcgtctgctcaggttgcagcaggagagagggaaaggtgagaaggag
cccccgagcccgggcatggagaggaagaggagcaggaggaggggtgtaggggccgacccc
gaggcgcgggcagaggctggtgagcagccaggcacagctgagcgggccctgctccgagat
cagcccaggggccgtggccagagaggggctcgccagagaaggaggacacctcggcccctg
accagtgcccgagcaaaggcggccaatgtccaggagccggagaagaagaagaaacgcagg
gagtga

DBGET integrated database retrieval system