KEGG   Homo sapiens (human): 857Help
Entry
857               CDS       T01001                                 

Gene name
CAV1, BSCL3, CGL3, LCCNS, MSTP085, PPH3, VIP21, CAV
Definition
(RefSeq) caveolin 1
  KO
K06278  caveolin 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04510  Focal adhesion
hsa05100  Bacterial invasion of epithelial cells
hsa05205  Proteoglycans in cancer
hsa05416  Viral myocarditis
hsa05418  Fluid shear stress and atherosclerosis
Disease
H00419  Congenital generalized lipodystrophy
H01621  Pulmonary arterial hypertension
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    857 (CAV1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    857 (CAV1)
 09160 Human Diseases
  09161 Cancers: Overview
   05205 Proteoglycans in cancer
    857 (CAV1)
  09166 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    857 (CAV1)
   05416 Viral myocarditis
    857 (CAV1)
  09171 Infectious diseases: Bacterial
   05100 Bacterial invasion of epithelial cells
    857 (CAV1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    857 (CAV1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    857 (CAV1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Caveolin
Motif
Other DBs
NCBI-GeneID: 857
NCBI-ProteinID: NP_001744
OMIM: 601047
HGNC: 1527
Ensembl: ENSG00000105974
Vega: OTTHUMG00000023413
Pharos: Q03135(Tbio)
UniProt: Q03135 Q2TNI1 Q59E85
Position
7q31.2
AA seq 178 aa AA seqDB search
MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLN
DDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFA
ILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgtctgggggcaaatacgtagactcggagggacatctctacaccgttcccatccgggaa
cagggcaacatctacaagcccaacaacaaggccatggcagacgagctgagcgagaagcaa
gtgtacgacgcgcacaccaaggagatcgacctggtcaaccgcgaccctaaacacctcaac
gatgacgtggtcaagattgactttgaagatgtgattgcagaaccagaagggacacacagt
tttgacggcatttggaaggccagcttcaccaccttcactgtgacgaaatactggttttac
cgcttgctgtctgccctctttggcatcccgatggcactcatctggggcatttacttcgcc
attctctctttcctgcacatctgggcagttgtaccatgcattaagagcttcctgattgag
attcagtgcatcagccgtgtctattccatctacgtccacaccgtctgtgacccactcttt
gaagctgttgggaaaatattcagcaatgtccgcatcaacttgcagaaagaaatataa

DBGET integrated database retrieval system