KEGG   Homo sapiens (human): 8570Help
Entry
8570              CDS       T01001                                 

Gene name
KHSRP, FBP2, FUBP2, KSRP, p75
Definition
(RefSeq) KH-type splicing regulatory protein
  KO
K13210  far upstream element-binding protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    8570 (KHSRP)
   03041 Spliceosome [BR:hsa03041]
    8570 (KHSRP)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Trans-acting binding proteins
     8570 (KHSRP)
Spliceosome [BR:hsa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    8570 (KHSRP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: KH_1 KH_2 DUF1897 KH_4
Motif
Other DBs
NCBI-GeneID: 8570
NCBI-ProteinID: NP_003676
OMIM: 603445
HGNC: 6316
Ensembl: ENSG00000088247
Vega: OTTHUMG00000180850
Pharos: Q92945(Tbio)
UniProt: Q92945
Structure
PDB: 

Position
19p13.3
AA seq 711 aa AA seqDB search
MSDYSTGGPPPGPPPPAGGGGGAGGAGGGPPPGPPGAGDRGGGGPGGGGPGGGSAGGPSQ
PPGGGGPGIRKDAFADAVQRARQIAAKIGGDAATTVNNSTPDFGFGGQKRQLEDGDQPES
KKLASQGDSISSQLGPIHPPPRTSMTEEYRVPDGMVGLIIGRGGEQINKIQQDSGCKVQI
SPDSGGLPERSVSLTGAPESVQKAKMMLDDIVSRGRGGPPGQFHDNANGGQNGTVQEIMI
PAGKAGLVIGKGGETIKQLQERAGVKMILIQDGSQNTNVDKPLRIIGDPYKVQQACEMVM
DILRERDQGGFGDRNEYGSRIGGGIDVPVPRHSVGVVIGRSGEMIKKIQNDAGVRIQFKQ
DDGTGPEKIAHIMGPPDRCEHAARIINDLLQSLRSGPPGPPGGPGMPPGGRGRGRGQGNW
GPPGGEMTFSIPTHKCGLVIGRGGENVKAINQQTGAFVEISRQLPPNGDPNFKLFIIRGS
PQQIDHAKQLIEEKIEGPLCPVGPGPGGPGPAGPMGPFNPGPFNQGPPGAPPHAGGPPPH
QYPPQGWGNTYPQWQPPAPHDPSKAAAAAADPNAAWAAYYSHYYQQPPGPVPGPAPAPAA
PPAQGEPPQPPPTGQSDYTKAWEEYYKKIGQQPQQPGAPPQQDYTKAWEEYYKKQAQVAT
GGGPGAPPGSQPDYSAAWAEYYRQQAAYYGQTPGPGGPQPPPTQQGQQQAQ
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atgtcggactacagcacgggaggacccccgcccgggccgccgccgcccgccggcgggggc
gggggagccggaggcgccgggggaggccctccgccgggcccgccaggcgcgggggaccgg
ggcggcggcggtcccggcggcggcggcccgggcggggggtcggccgggggcccctctcag
ccacccggcggaggcggcccgggaatccgcaaggacgctttcgccgacgccgtgcagcgg
gcccgccagattgcagccaaaattggaggcgatgctgccacgacagtgaataacagcact
cctgattttggttttgggggccaaaagagacagttggaagatggagatcaaccggagagc
aagaagctggcttcccagggagactcaatcagttctcaacttggacccatccatcctccc
ccaaggacttcaatgacagaagagtacagggtcccagacggcatggtgggcctgatcatt
ggcagaggaggtgaacaaattaacaaaatccaacaggattcaggctgcaaagtacagatt
tctccagacagcggtggcctacccgagcgcagtgtgtccttgacaggagccccagaatct
gtccagaaagccaagatgatgctggatgacattgtgtctcggggtcgtgggggcccccca
ggacagttccacgacaacgccaacgggggccagaacggcaccgtgcaggagatcatgatc
cccgcgggcaaggccggcctggtcattggcaagggcggggagaccattaagcagctgcag
gaacgcgctggagtgaagatgatcttaattcaggacggatctcagaatacgaatgtggac
aaacctctccgcatcattggggatccttacaaagtgcagcaagcctgtgagatggtgatg
gacatcctccgggaacgtgaccaaggcggctttggggaccggaatgagtacggatctcgg
attggcggaggcatcgatgtgccagtgcccaggcattctgttggcgtggtcattggccgg
agtggagagatgatcaagaagatccagaatgatgctggcgtgcggatacagttcaagcaa
gatgacgggacagggcccgagaagattgctcatataatggggcccccagacaggtgcgag
cacgcagcccggatcatcaacgacctcctccagagcctcaggagtggtcccccaggtcct
ccagggggtccaggcatgcccccggggggccgaggccgaggaagaggccaaggcaattgg
ggtccccctggcggggagatgaccttctccatccccactcacaagtgtgggctggtcatc
ggccgaggtggcgagaatgtgaaagccataaaccagcagacgggagccttcgtagagatc
tcccggcagctgccacccaacggggaccccaacttcaagttgttcatcatccggggttca
ccccagcagattgaccacgccaagcagcttatcgaggaaaagatcgagggtcctctctgc
ccagttggaccaggcccaggtggcccaggccctgctggcccaatggggcccttcaatcct
gggcccttcaaccaggggccacccggggctcccccacatgccggggggccccctcctcac
cagtacccaccccagggctggggcaatacctacccccagtggcagccgcctgctcctcat
gacccaagcaaagcagctgcagcggccgcggaccccaacgccgcgtgggccgcctactac
tcacactactaccagcagcccccgggccccgtccccggccccgcaccggcccctgcggcc
ccaccggctcagggtgagccccctcagcccccacccaccggccagtcggactacactaag
gcctgggaagagtattacaaaaagatcggccagcagccccagcagcccggagcaccccca
cagcaggactacacgaaggcttgggaggagtactacaagaagcaagcgcaagtggccacc
ggagggggtccaggagctcccccaggctcccagccagactacagtgccgcctgggcggaa
tattacagacagcaggccgcttactacggacagaccccaggtcctggcggcccccagccg
ccgcccacgcagcagggacagcagcaggctcaatga

DBGET integrated database retrieval system