KEGG   Homo sapiens (human): 8573
Entry
8573              CDS       T01001                                 
Symbol
CASK, CAGH39, CAMGUK, CMG, FGS4, LIN2, MICPCH, MRXSNA, TNRC8, hCASK
Name
(RefSeq) calcium/calmodulin dependent serine protein kinase
  KO
K06103  calcium/calmodulin-dependent serine protein kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Disease
H00894  FG syndrome
H01921  MICPCH syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    8573 (CASK)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    8573 (CASK)
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:hsa03037]
    8573 (CASK)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     8573 (CASK)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CAMK group
  CASK family
   8573 (CASK)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    8573 (CASK)
Cilium and associated proteins [BR:hsa03037]
 Primary cilia and associated proteins
  USH complex and associated proteins
   8573 (CASK)
SSDB
Motif
Pfam: Pkinase Guanylate_kin PK_Tyr_Ser-Thr L27 PDZ SH3_1 SH3_2 Pkinase_fungal PDZ_6 SH3_9 PDZ_2
Other DBs
NCBI-GeneID: 8573
NCBI-ProteinID: NP_003679
OMIM: 300172
HGNC: 1497
Ensembl: ENSG00000147044
Pharos: O14936(Tbio)
UniProt: O14936
Structure
Position
X:complement(41514934..41923554)
AA seq 921 aa
MADDDVLFEDVYELCEVIGKGPFSVVRRCINRETGQQFAVKIVDVAKFTSSPGLSTEDLK
REASICHMLKHPHIVELLETYSSDGMLYMVFEFMDGADLCFEIVKRADAGFVYSEAVASH
YMRQILEALRYCHDNNIIHRDVKPHCVLLASKENSAPVKLGGFGVAIQLGESGLVAGGRV
GTPHFMAPEVVKREPYGKPVDVWGCGVILFILLSGCLPFYGTKERLFEGIIKGKYKMNPR
QWSHISESAKDLVRRMLMLDPAERITVYEALNHPWLKERDRYAYKIHLPETVEQLRKFNA
RRKLKGAVLAAVSSHKFNSFYGDPPEELPDFSEDPTSSGLLAAERAVSQVLDSLEEIHAL
TDCSEKDLDFLHSVFQDQHLHTLLDLYDKINTKSSPQIRNPPSDAVQRAKEVLEEISCYP
ENNDAKELKRILTQPHFMALLQTHDVVAHEVYSDEALRVTPPPTSPYLNGDSPESANGDM
DMENVTRVRLVQFQKNTDEPMGITLKMNELNHCIVARIMHGGMIHRQGTLHVGDEIREIN
GISVANQTVEQLQKMLREMRGSITFKIVPSYRTQSSSCERDSPSTSRQSPANGHSSTNNS
VSDLPSTTQPKGRQIYVRAQFEYDPAKDDLIPCKEAGIRFRVGDIIQIISKDDHNWWQGK
LENSKNGTAGLIPSPELQEWRVACIAMEKTKQEQQASCTWFGKKKKQYKDKYLAKHNADL
VTYEEVVKLPAFKRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPKKDEENG
KNYYFVSHDQMMQDISNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIAILDVEPQALKVL
RTAEFAPFVVFIAAPTITPGLNEDESLQRLQKESDILQRTYAHYFDLTIINNEIDETIRH
LEEAVELVCTAPQWVPVSWVY
NT seq 2766 nt   +upstreamnt  +downstreamnt
atggccgacgacgacgtgctgttcgaggatgtgtacgagctgtgcgaggtgatcggaaag
ggtcccttcagtgttgtacgacgatgtatcaacagagaaactgggcaacaatttgctgta
aaaattgttgatgtagccaagttcacatcaagtccagggttaagtacagaagatctaaag
cgggaagccagtatctgtcatatgctgaaacatccacacattgtagagttattggagaca
tatagctcagatggaatgctttacatggttttcgaatttatggatggagcagatctgtgt
tttgaaatcgtaaagcgagctgacgctggttttgtgtacagtgaagctgtagccagccat
tatatgagacagatactggaagctctacgctactgccatgataataacataattcacagg
gatgtgaagccccactgtgttctccttgcctcaaaagaaaactcggcacctgttaaactt
ggaggctttggggtagctattcaattaggggagtctggacttgtagctggaggacgtgtt
ggaacacctcattttatggcaccagaagtggtcaaaagagagccttacggaaagcctgta
gacgtctgggggtgcggtgtgatcctttttatcctgctcagtggttgtttgcctttttac
ggaaccaaggaaagattgtttgaaggcattattaaaggaaaatataagatgaatccaagg
cagtggagccatatctctgaaagtgccaaagacctagtacgtcgcatgctgatgctggat
ccagctgaaaggatcactgtttatgaagcactgaatcacccatggcttaaggagcgggat
cgttacgcctacaagattcatcttccagaaacagtagagcagctgaggaaattcaatgca
aggaggaaactaaagggtgcagtactagccgctgtgtcaagtcacaaattcaactcattc
tatggggatccccctgaagagttaccagatttctccgaagaccctacctcctcaggactt
ctagcagcagaaagagcagtctcacaggtgctggacagcctggaagagattcatgcgctt
acagactgcagtgaaaaggacctagattttctacacagtgttttccaggatcagcatctt
cacacactactagatctgtatgacaaaattaacacaaagtcttcaccacaaatcaggaat
cctccaagcgatgcagtacagagagccaaagaggtattggaagaaatttcatgttaccct
gagaataacgacgcaaaggaactaaagcgtattttaacacaacctcatttcatggcctta
cttcagactcacgacgtagtggcacatgaagtttacagtgatgaagcattgagggtcaca
cctcctcccacctctccctatttaaacggcgattctccagaaagtgctaacggagacatg
gatatggagaatgtgaccagagttcggctggtacagtttcaaaagaacacagatgaacca
atgggaatcactttaaaaatgaatgaactaaatcattgtattgttgcaagaattatgcat
gggggcatgattcacaggcaaggtacacttcatgttggtgatgaaattcgagaaatcaat
ggcatcagtgtggctaaccaaacagtggaacaactgcaaaaaatgcttagggaaatgcgg
gggagtattaccttcaagattgtgccaagttaccgcactcagtcttcgtcctgtgagaga
gattccccttccacttccagacagtccccagctaatggtcatagcagcactaacaattct
gtttcggacttgccatcaactacccaaccaaaaggacgacagatctatgtaagagcacaa
tttgaatatgatccagccaaggatgacctcatcccctgtaaagaagctggcattcgattc
agagttggtgacatcatccagattattagtaaggatgatcataattggtggcagggtaaa
ctggaaaactccaaaaatggaactgcaggtctcattccttctcctgaacttcaggaatgg
cgagtagcttgcattgccatggagaagaccaaacaggagcagcaggccagctgtacttgg
tttggcaagaaaaagaagcagtacaaagataaatatttggcaaagcacaatgcagatctt
gtcacatatgaagaagtagtaaaactgccagcattcaagaggaaaacactagtcttatta
ggcgcacatggtgttgggagaagacacataaaaaacactctcatcacaaagcacccagac
cggtttgcgtaccctattccacatacaaccagacctccaaagaaagacgaagaaaatgga
aagaattattactttgtatctcatgaccaaatgatgcaagacatctctaataacgagtac
ttggagtacggcagccacgaggatgcgatgtatgggacaaaactggagaccatccggaag
atccacgagcaggggctgattgcaatactggacgtggagcctcaggcactgaaggtcctg
agaactgcagagtttgctccttttgttgttttcattgctgcaccaactattactccaggt
ttaaatgaggatgaatctcttcagcgtctgcagaaggagtctgacatcttacagagaaca
tatgcacactacttcgatctcacaattatcaacaatgaaattgatgagacaatcagacat
ctggaggaagctgttgagctcgtgtgcacagccccacagtgggtccctgtctcctgggtc
tattag

DBGET integrated database retrieval system