KEGG   Homo sapiens (human): 8574Help
Entry
8574              CDS       T01001                                 

Gene name
AKR7A2, AFAR, AFAR1, AFB1-AR1, AKR7
Definition
(RefSeq) aldo-keto reductase family 7 member A2
  KO
K15303  aflatoxin B1 aldehyde reductase
Organism
hsa  Homo sapiens (human)
Pathway
hsa00980  Metabolism of xenobiotics by cytochrome P450
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    8574 (AKR7A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldo_ket_red
Motif
Other DBs
NCBI-GeneID: 8574
NCBI-ProteinID: NP_003680
OMIM: 603418
HGNC: 389
Ensembl: ENSG00000053371
Vega: OTTHUMG00000002522
Pharos: O43488(Tbio)
UniProt: O43488 V9HWA2
Structure
PDB: 

Position
1p36.13
AA seq 359 aa AA seqDB search
MLSAASRVVSRAAVHCALRSPPPEARALAMSRPPPPRVASVLGTMEMGRRMDAPASAAAV
RAFLERGHTELDTAFMYSDGQSETILGGLGLGLGGGDCRVKIATKANPWDGKSLKPDSVR
SQLETSLKRLQCPQVDLFYLHAPDHGTPVEETLHACQRLHQEGKFVELGLSNYASWEVAE
ICTLCKSNGWILPTVYQGMYNATTRQVETELFPCLRHFGLRFYAYNPLAGGLLTGKYKYE
DKDGKQPVGRFFGNSWAETYRNRFWKEHHFEAIALVEKALQAAYGASAPSVTSAALRWMY
HHSQLQGAHGDAVILGMSSLEQLEQNLAATEEGPLEPAVVDAFNQAWHLVAHECPNYFR
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgctgagtgccgcgtctcgcgtagtctcccgcgccgccgtccactgcgcgcttcgctct
ccgccgcccgaggcccgcgcgctcgccatgtcccggccaccgccaccgcgggtcgcctcg
gtgctgggcaccatggagatggggcgccgcatggacgcgcccgccagcgccgcggccgtg
cgcgcctttctggagcgcggccacaccgaactggacacggccttcatgtacagcgacggc
cagtccgagaccatcctgggcggcctggggctcgggctgggcggtggcgactgcagagtg
aaaattgccaccaaggccaacccttgggatggaaaatcactaaagcctgacagtgtccgg
tcccagctggagacgtcattgaagaggctgcagtgtccccaagtggacctcttctaccta
cacgcacctgaccacggcaccccggtggaagagacgctgcatgcctgccagcggctgcac
caggagggcaagttcgtggagcttggcctctccaactatgctagctgggaagtggccgag
atctgtaccctctgcaagagcaatggctggatcctgcccactgtgtaccagggcatgtac
aacgccaccacccggcaggtggaaacggagctcttcccctgcctcaggcactttggactg
aggttctatgcctacaaccctctggctgggggcctgctgactggcaagtacaagtatgag
gacaaggacgggaaacagcctgtgggccgcttctttgggaatagctgggctgagacctac
aggaatcgcttctggaaggagcaccacttcgaggccattgcgttggtggagaaggccctg
caggccgcatatggcgccagcgcccccagtgtgacctcggctgccctccggtggatgtac
caccactcacagctgcagggtgcccacggggacgcggtcatcctgggcatgtccagcctg
gagcagctggagcagaacttggcagcaacagaggaagggcccctggagccggctgtcgtg
gatgcctttaatcaagcctggcatttggttgctcacgaatgtcccaactacttccgctag

DBGET integrated database retrieval system