KEGG   Homo sapiens (human): 8575Help
Entry
8575              CDS       T01001                                 

Gene name
PRKRA, DYT16, HSD14, PACT, RAX
Definition
(RefSeq) protein activator of interferon induced protein kinase EIF2AK2
Organism
hsa  Homo sapiens (human)
Disease
H00831  Primary dystonia
SSDB OrthologParalogGFIT
Motif
Pfam: dsrm Staufen_C DND1_DSRM APO_RNA-bind
Motif
Other DBs
NCBI-GeneID: 8575
NCBI-ProteinID: NP_003681
OMIM: 603424
HGNC: 9438
Ensembl: ENSG00000180228
Vega: OTTHUMG00000132576
Pharos: O75569(Tbio)
UniProt: O75569
Structure
PDB: 

Position
2q31.2
AA seq 313 aa AA seqDB search
MSQSRHRAEAPPLEREDSGTFSLGKMITAKPGKTPIQVLHEYGMKTKNIPVYECERSDVQ
IHVPTFTFRVTVGDITCTGEGTSKKLAKHRAAEAAINILKANASICFAVPDPLMPDPSKQ
PKNQLNPIGSLQELAIHHGWRLPEYTLSQEGGPAHKREYTTICRLESFMETGKGASKKQA
KRNAAEKFLAKFSNISPENHISLTNVVGHSLGCTWHSLRNSPGEKINLLKRSLLSIPNTD
YIQLLSEIAKEQGFNITYLDIDELSANGQYQCLAELSTSPITVCHGSGISCGNAQSDAAH
NALQYLKIIAERK
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagagcaggcaccgcgccgaggccccgccgctggagcgcgaggacagtgggacc
ttcagtttggggaagatgataacagctaagccagggaaaacaccgattcaggtattacac
gaatacggcatgaagaccaagaacatcccagtttatgaatgtgaaagatctgatgtgcaa
atacacgtgcccactttcaccttcagagtaaccgttggtgacataacctgcacaggtgaa
ggtacaagtaagaagctggcgaaacatagagctgcagaggctgccataaacattttgaaa
gccaatgcaagtatttgctttgcagttcctgaccccttaatgcctgacccttccaagcaa
ccaaagaaccagcttaatcctattggttcattacaggaattggctattcatcatggctgg
agacttcctgaatataccctttcccaggagggaggacctgctcataagagagaatatact
acaatttgcaggctagagtcatttatggaaactggaaagggggcatcaaaaaagcaagcc
aaaaggaatgctgctgagaaatttcttgccaaatttagtaatatttctccagagaaccac
atttctttaacaaatgtagtaggacattctttaggatgtacttggcattccttgaggaat
tctcctggtgaaaagatcaacttactgaaaagaagcctccttagtattccaaatacagat
tacatccagctgcttagtgaaattgccaaggaacaaggttttaatataacatatttggat
atagatgaactgagcgccaatggacaatatcaatgtcttgctgaactgtccaccagcccc
atcacagtctgtcatggctccggtatctcctgtggcaatgcacaaagtgatgcagctcac
aatgctttgcagtatttaaagataatagcagaaagaaagtaa

DBGET integrated database retrieval system