KEGG   Homo sapiens (human): 8576
Entry
8576              CDS       T01001                                 

Gene name
STK16, KRCT, MPSK, PKL12, PSK, TSF1, hPSK
Definition
(RefSeq) serine/threonine kinase 16
  KO
K08856  serine/threonine kinase 16 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    8576 (STK16)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     8576 (STK16)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  NAK family [OT]
   8576 (STK16)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Kdo Pox_ser-thr_kin
Other DBs
NCBI-GeneID: 8576
NCBI-ProteinID: NP_001008910
OMIM: 604719
HGNC: 11394
Ensembl: ENSG00000115661
Vega: OTTHUMG00000154520
Pharos: O75716(Tchem)
UniProt: O75716
Structure
PDB: 
2BUJ

Position
2q35
AA seq 305 aa
MGHALCVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGLHDGHFYALKRILCHEQQDRE
EAQREADMHRLFNHPNILRLVAYCLRERGAKHEAWLLLPFFKRGTLWNEIERLKDKGNFL
TEDQILWLLLGICRGLEAIHAKGYAHRDLKPTNILLGDEGQPVLMDLGSMNQACIHVEGS
RQALTLQDWAAQRCTISYRAPELFSVQSHCVIDERTDVWSLGCVLYAMMFGEGPYDMVFQ
KGDSVALAVQNQLSIPQSPRHSSALRQLLNSMMTVDPHQRPHIPLLLSQLEALQPPAPGQ
HTTQI
NT seq 918 nt   +upstreamnt  +downstreamnt
atgggccacgcgctgtgtgtctgctctcggggaactgtcatcattgacaataagcgctac
ctcttcatccagaaactgggggagggtgggttcagctatgtggacctagtggaagggtta
catgatggacacttctacgccctgaagcgaatcctgtgtcacgagcagcaggaccgggag
gaggcccagcgagaagccgacatgcatcgcctcttcaatcaccccaacatccttcgcctc
gtggcttactgtctgagggaacggggtgctaagcatgaggcctggctgctgctaccattc
ttcaagagaggtacgctgtggaatgagatagaaaggctgaaggacaaaggcaacttcctg
accgaggatcaaatcctttggctgctgctggggatctgcagaggccttgaggccattcat
gccaagggttatgcccacagagacttgaagcccaccaatatattgcttggagatgagggg
cagccagttttaatggacttgggttccatgaatcaagcatgcatccatgtggagggctcc
cgccaggctctgaccctgcaggactgggcagcccagcggtgcaccatctcctaccgagcc
ccagagctcttctctgtgcagagtcactgtgtcatcgatgagcggactgatgtctggtcc
ctaggctgcgtgctatatgccatgatgtttggggaaggcccttatgacatggtgttccaa
aagggtgacagtgtggcccttgctgtgcagaaccaactcagcatcccacaaagccccagg
cattcttcagcattgcggcagctcctgaactcgatgatgaccgtggacccgcatcagcgt
cctcacattcctctcctcctcagtcagctggaggcgcttcagcccccagctcctggccaa
catactacccaaatctga

DBGET integrated database retrieval system