KEGG   Homo sapiens (human): 8601Help
Entry
8601              CDS       T01001                                 

Gene name
RGS20, RGSZ1, ZGAP1, g(z)GAP, gz-GAP
Definition
(RefSeq) regulator of G protein signaling 20
  KO
K16449  regulator of G-protein signaling
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    8601 (RGS20)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RGS
Motif
Other DBs
NCBI-GeneID: 8601
NCBI-ProteinID: NP_733466
OMIM: 607193
HGNC: 14600
Ensembl: ENSG00000147509
Vega: OTTHUMG00000164750
Pharos: O76081(Tbio)
UniProt: O76081
Position
8q11.23
AA seq 388 aa AA seqDB search
MPQLSQDNQECLQKHFSRPSIWTQFLPLFRAQRYNTDIHQITENEGDLRAVPDIKSFPPA
QLPDSPAAPKLFGLLSSPLSSLARFFSHLLRRPPPEAPRRRLDFSPLLPALPAARLSRGH
EELPGRLSLLLGAALALPGRPSGGRPLRPPHPVAKPREEDATAGQSSPMPQMGSERMEMR
KRQMPAAQDTPGAAPGQPGAGSRGSNACCFCWCCCCSCSCLTVRNQEDQRPTIASHELRA
DLPTWEESPAPTLEEVNAWAQSFDKLMVTPAGRNAFREFLRTEFSEENMLFWMACEELKK
EANKNIIEEKARIIYEDYISILSPKEVSLDSRVREVINRNMVEPSQHIFDDAQLQIYTLM
HRDSYPRFMNSAVYKDLLQSLSEKSIEA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgccccagctttcccaagataaccaagagtgcctccagaaacatttctccaggccgtct
atatggacacagtttctgcccctgttcagggctcagagatataatacagacattcaccaa
atcacagaaaatgaaggagacctcagggctgttcctgatatcaagtccttcccgcctgca
cagctcccagactcgcccgccgccccgaagctgttcggcctcctttctagcccgctttcc
agcctcgcaaggttcttctctcaccttctccggcgaccccctcccgaggctccccggagg
cgcctggacttctcccccctgcttcccgccctgccggccgcccggctctcgagggggcac
gaggagctgccgggccgcctctcgctcctgctcggggcggcgctggcactgcccggccga
ccctcggggggtcgtccgctgaggcccccccatccggtagccaagcccagggaagaagac
gccaccgctgggcagagctcgcctatgccgcagatgggatcagagcggatggagatgcgg
aagcggcagatgcccgccgcccaggacacaccaggcgccgccccaggccagcccggagcg
gggagtcgcgggtccaacgcatgctgcttctgctggtgctgctgttgtagctgctcgtgt
ctcactgttagaaaccaggaagatcagaggcccacaatagcttcccacgaactcagagca
gatcttccaacctgggaagaaagccctgctcctactctggaagaagtcaacgcctgggct
cagtcatttgacaaattaatggtcactccagcaggaaggaatgcattccgtgaattcctc
cgaacagaattcagtgaggaaaatatgctcttctggatggcctgtgaggaactgaaaaag
gaagctaataaaaacattattgaagagaaagcaaggataatctatgaagactacatttct
atactttctcctaaggaggtgagcttagactcccgggtgagagaagtgatcaacagaaac
atggtggagccatcccaacacatattcgatgatgctcaacttcagatttacaccctgatg
cacagagactcatatcctcgattcatgaactctgctgtctataaggacttgcttcagtcc
ttatcggagaaatctattgaagcatag

DBGET integrated database retrieval system