KEGG   Homo sapiens (human): 8605Help
Entry
8605              CDS       T01001                                 

Gene name
PLA2G4C, CPLA2-gamma
Definition
(RefSeq) phospholipase A2 group IVC
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00564  Glycerophospholipid metabolism
hsa00565  Ether lipid metabolism
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa00592  alpha-Linolenic acid metabolism
hsa01100  Metabolic pathways
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04217  Necroptosis
hsa04270  Vascular smooth muscle contraction
hsa04370  VEGF signaling pathway
hsa04611  Platelet activation
hsa04664  Fc epsilon RI signaling pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa04724  Glutamatergic synapse
hsa04726  Serotonergic synapse
hsa04730  Long-term depression
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04912  GnRH signaling pathway
hsa04913  Ovarian steroidogenesis
hsa04921  Oxytocin signaling pathway
hsa05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    8605 (PLA2G4C)
   00565 Ether lipid metabolism
    8605 (PLA2G4C)
   00590 Arachidonic acid metabolism
    8605 (PLA2G4C)
   00591 Linoleic acid metabolism
    8605 (PLA2G4C)
   00592 alpha-Linolenic acid metabolism
    8605 (PLA2G4C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    8605 (PLA2G4C)
   04010 MAPK signaling pathway
    8605 (PLA2G4C)
   04370 VEGF signaling pathway
    8605 (PLA2G4C)
   04072 Phospholipase D signaling pathway
    8605 (PLA2G4C)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    8605 (PLA2G4C)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    8605 (PLA2G4C)
   04664 Fc epsilon RI signaling pathway
    8605 (PLA2G4C)
   04666 Fc gamma R-mediated phagocytosis
    8605 (PLA2G4C)
  09152 Endocrine system
   04912 GnRH signaling pathway
    8605 (PLA2G4C)
   04913 Ovarian steroidogenesis
    8605 (PLA2G4C)
   04921 Oxytocin signaling pathway
    8605 (PLA2G4C)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    8605 (PLA2G4C)
  09156 Nervous system
   04724 Glutamatergic synapse
    8605 (PLA2G4C)
   04726 Serotonergic synapse
    8605 (PLA2G4C)
   04730 Long-term depression
    8605 (PLA2G4C)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    8605 (PLA2G4C)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    8605 (PLA2G4C)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     8605 (PLA2G4C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B
Motif
Other DBs
NCBI-GeneID: 8605
NCBI-ProteinID: NP_003697
OMIM: 603602
HGNC: 9037
Ensembl: ENSG00000105499
Vega: OTTHUMG00000183185
Pharos: Q9UP65(Tchem)
UniProt: Q9UP65 A0A024QZH0
Position
19q13.33
AA seq 541 aa AA seqDB search
MGSSEVSIIPGLQKEEKAAVERRRLHVLKALKKLRIEADEAPVVAVLGSGGGLRAHIACL
GVLSEMKEQGLLDAVTYLAGVSGSTWAISSLYTNDGDMEALEADLKHRFTRQEWDLAKSL
QKTIQAARSENYSLTDFWAYMVISKQTRELPESHLSNMKKPVEEGTLPYPIFAAIDNDLQ
PSWQEARAPETWFEFTPHHAGFSALGAFVSITHFGSKFKKGRLVRTHPERDLTFLRGLWG
SALGNTEVIREYIFDQLRNLTLKGLWRRAVANAKSIGHLIFARLLRLQESSQGEHPPPED
EGGEPEHTWLTEMLENWTRTSLEKQEQPHEDPERKGSLSNLMDFVKKTGICASKWEWGTT
HNFLYKHGGIRDKIMSSRKHLHLVDAGLAINTPFPLVLPPTREVHLILSFDFSAGDPFET
IRATTDYCRRHKIPFPQVEEAELDLWSKAPASCYILKGETGPVVMHFPLFNIDACGGDIE
AWSDTYDTFKLADTYTLDVVVLLLALAKKNVRENKKKILRELMNVAGLYYPKDSARSCCL
A
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgggaagctctgaagtttccataattcctgggctccagaaagaagaaaaggcggccgtg
gagagacgaagacttcatgtgctgaaagctctgaagaagctaaggattgaggctgatgag
gccccagttgttgctgtgctgggctcaggcggaggactgcgggctcacattgcctgcctt
ggggtcctgagtgagatgaaagaacagggcctgttggatgccgtcacgtacctcgcaggg
gtctctggatccacttgggcaatatcttctctctacaccaatgatggtgacatggaagct
ctcgaggctgacctgaaacatcgatttacccgacaggagtgggacttggctaagagccta
cagaaaaccatccaagcagcgaggtctgagaattactctctgaccgacttctgggcctac
atggttatctctaagcaaaccagagaactgccggagtctcatttgtccaatatgaagaag
cccgtggaagaagggacactaccctacccaatatttgcagccattgacaatgacctgcaa
ccttcctggcaggaggcaagagcaccagagacctggttcgagttcacccctcaccacgct
ggcttctctgcactgggggcctttgtttccataacccacttcggaagcaaattcaagaag
ggaagactggtcagaactcaccctgagagagacctgactttcctgagaggtttatgggga
agtgctcttggtaacactgaagtcattagggaatacatttttgaccagttaaggaatctg
accctgaaaggtttatggagaagggctgttgctaatgctaaaagcattggacaccttatt
tttgcccgattactgaggctgcaagaaagttcacaaggggaacatcctcccccagaagat
gaaggcggtgagcctgaacacacctggctgactgagatgctcgagaattggaccaggacc
tccctggaaaagcaggagcagccccatgaggaccccgaaaggaaaggctcactcagtaac
ttgatggattttgtgaagaaaacaggcatttgcgcttcaaagtgggaatgggggaccact
cacaacttcctgtacaaacacggtggcatccgggacaagataatgagcagccggaagcac
ctccacctggtggatgctggtttagccatcaacactcccttcccactcgtgctgcccccg
acgcgggaggttcacctcatcctctccttcgacttcagtgccggagatcctttcgagacc
atccgggctaccactgactactgccgccgccacaagatcccctttccccaagtagaagag
gctgagctggatttgtggtccaaggcccccgccagctgctacatcctgaaaggagaaact
ggaccagtggtgatgcattttcccctgttcaacatagatgcctgtggaggtgatattgag
gcatggagtgacacatacgacacattcaagcttgctgacacctacactctagatgtggtg
gtgctactcttggcattagccaagaagaatgtcagggaaaacaagaagaagatccttaga
gagttgatgaacgtggccgggctctactacccgaaggatagtgcccgaagttgctgcttg
gcatag

DBGET integrated database retrieval system