KEGG   Homo sapiens (human): 8607
Entry
8607              CDS       T01001                                 
Symbol
RUVBL1, ECP-54, ECP54, INO80H, NMP_238, NMP238, PONTIN, Pontin52, RVB1, TIH1, TIP49, TIP49A
Name
(RefSeq) RuvB like AAA ATPase 1
  KO
K04499  RuvB-like protein 1 [EC:5.6.2.4]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    8607 (RUVBL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8607 (RUVBL1)
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:hsa03037]
    8607 (RUVBL1)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.4  DNA 3'-5' helicase
     8607 (RUVBL1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     8607 (RUVBL1)
  Chromatin remodeling factors
   SRCAP complex
    8607 (RUVBL1)
   INO80 complex
    8607 (RUVBL1)
   INO80 complex (yeast)
    8607 (RUVBL1)
   SWR1 complex
    8607 (RUVBL1)
   ASTRA complex
    8607 (RUVBL1)
Cilium and associated proteins [BR:hsa03037]
 Motile cilia and associated proteins
  Dynein assembly factors
   8607 (RUVBL1)
SSDB
Motif
Pfam: TIP49 TIP49_C AAA RuvB_N AAA_22 AAA_5 AAA_16 Sigma54_activat bpMoxR Mg_chelatase AAA_25 AAA_19 AAA_18 AAA_28 IstB_IS21 DnaB_C Zeta_toxin TsaE ResIII AAA_7 AAA_33 NACHT Parvo_NS1 PhoH AAA_11 AAA_30 NTPase_1 ATPase DUF2075 RNA_helicase
Other DBs
NCBI-GeneID: 8607
NCBI-ProteinID: NP_003698
OMIM: 603449
HGNC: 10474
Ensembl: ENSG00000175792
Pharos: Q9Y265(Tbio)
UniProt: Q9Y265 A0A384MTR5
Structure
Position
3:complement(128064785..128153914)
AA seq 456 aa
MKIEEVKSTTKTQRIASHSHVKGLGLDESGLAKQAASGLVGQENAREACGVIVELIKSKK
MAGRAVLLAGPPGTGKTALALAIAQELGSKVPFCPMVGSEVYSTEIKKTEVLMENFRRAI
GLRIKETKEVYEGEVTELTPCETENPMGGYGKTISHVIIGLKTAKGTKQLKLDPSIFESL
QKERVEAGDVIYIEANSGAVKRQGRCDTYATEFDLEAEEYVPLPKGDVHKKKEIIQDVTL
HDLDVANARPQGGQDILSMMGQLMKPKKTEITDKLRGEINKVVNKYIDQGIAELVPGVLF
VDEVHMLDIECFTYLHRALESSIAPIVIFASNRGNCVIRGTEDITSPHGIPLDLLDRVMI
IRTMLYTPQEMKQIIKIRAQTEGINISEEALNHLGEIGTKTTLRYSVQLLTPANLLAKIN
GKDSIEKEHVEEISELFYDAKSSAKILADQQDKYMK
NT seq 1371 nt   +upstreamnt  +downstreamnt
atgaagattgaggaggtgaagagcactacgaagacgcagcgcatcgcctcccacagccac
gtgaaagggctggggctggacgagagcggcttggccaagcaggcggcctcagggcttgtg
ggccaggagaacgcgcgagaggcatgtggcgtcatagtagaattaatcaaaagcaagaaa
atggctggaagagctgtcttgttggcaggacctcctggaactggcaagacagctctggct
ctggctattgctcaggagctgggtagtaaggtccccttctgcccaatggtggggagtgaa
gtttactcaactgagatcaagaagacagaggtgctgatggagaacttccgcagggccatt
gggctgcgaataaaggagaccaaggaagtttatgaaggtgaagtcacagagctaactccg
tgtgagacagagaatcccatgggaggatatggcaaaaccattagccatgtgatcatagga
ctcaaaacagccaaaggaaccaaacagttgaaactggaccccagcatttttgaaagtttg
cagaaagagcgagtagaagctggagatgtgatttacattgaagccaacagtggggccgtg
aagaggcagggcaggtgtgatacctatgccacagaattcgaccttgaagctgaagagtat
gtccccttgccaaaaggggatgtgcacaaaaagaaagaaatcatccaagatgtgaccttg
catgacttggatgtggctaatgcgcggccccaggggggacaagatatcctgtccatgatg
ggccagctaatgaagccaaagaagacagaaatcacagacaaacttcgaggggagattaat
aaggtggtgaacaagtacatcgaccagggcattgctgagctggtcccgggtgtgctgttt
gttgatgaggtccacatgctggacattgagtgcttcacctacctgcaccgcgccctggag
tcttctatcgctcccatcgtcatctttgcatccaaccgaggcaactgtgtcatcagaggc
actgaggacatcacatcccctcacggcatccctcttgaccttctggaccgagtgatgata
atccggaccatgctgtatactccacaggaaatgaaacagatcattaaaatccgtgcccag
acggaaggaatcaacatcagtgaggaggcactgaaccacctgggggagattggcaccaag
accacactgaggtactcagtgcagctgctgaccccggccaacttgcttgctaaaatcaac
gggaaggacagcattgagaaagagcatgtcgaagagatcagtgaacttttctatgatgcc
aagtcctccgccaaaatcctggctgaccagcaggataagtacatgaagtga

DBGET integrated database retrieval system