KEGG   Homo sapiens (human): 8607Help
Entry
8607              CDS       T01001                                 

Gene name
RUVBL1, ECP-54, ECP54, INO80H, NMP_238, NMP238, PONTIN, Pontin52, RVB1, TIH1, TIP49, TIP49A
Definition
(RefSeq) RuvB like AAA ATPase 1
  KO
K04499  RuvB-like protein 1 (pontin 52)
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    8607 (RUVBL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8607 (RUVBL1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     8607 (RUVBL1)
  Chromatin remodeling factors
   SRCAP complex
    8607 (RUVBL1)
   INO80 complex
    8607 (RUVBL1)
   INO80 complex (yeast)
    8607 (RUVBL1)
   SWR1 complex
    8607 (RUVBL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIP49 TIP49_C AAA RuvB_N AAA_22 AAA_16 AAA_5 AAA_25 Sigma54_activat Mg_chelatase AAA_19 IstB_IS21 AAA_18 AAA_28 DnaB_C ResIII AAA_33 Zeta_toxin PhoH NACHT TsaE AAA_7 Parvo_NS1 AAA_11 AAA_30 ATPase DUF2075 RNA_helicase
Motif
Other DBs
NCBI-GeneID: 8607
NCBI-ProteinID: NP_003698
OMIM: 603449
HGNC: 10474
Ensembl: ENSG00000175792
Vega: OTTHUMG00000159658
Pharos: Q9Y265(Tbio)
UniProt: Q9Y265
Structure
PDB: 

Position
3q21.3
AA seq 456 aa AA seqDB search
MKIEEVKSTTKTQRIASHSHVKGLGLDESGLAKQAASGLVGQENAREACGVIVELIKSKK
MAGRAVLLAGPPGTGKTALALAIAQELGSKVPFCPMVGSEVYSTEIKKTEVLMENFRRAI
GLRIKETKEVYEGEVTELTPCETENPMGGYGKTISHVIIGLKTAKGTKQLKLDPSIFESL
QKERVEAGDVIYIEANSGAVKRQGRCDTYATEFDLEAEEYVPLPKGDVHKKKEIIQDVTL
HDLDVANARPQGGQDILSMMGQLMKPKKTEITDKLRGEINKVVNKYIDQGIAELVPGVLF
VDEVHMLDIECFTYLHRALESSIAPIVIFASNRGNCVIRGTEDITSPHGIPLDLLDRVMI
IRTMLYTPQEMKQIIKIRAQTEGINISEEALNHLGEIGTKTTLRYSVQLLTPANLLAKIN
GKDSIEKEHVEEISELFYDAKSSAKILADQQDKYMK
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgaagattgaggaggtgaagagcactacgaagacgcagcgcatcgcctcccacagccac
gtgaaagggctggggctggacgagagcggcttggccaagcaggcggcctcagggcttgtg
ggccaggagaacgcgcgagaggcatgtggcgtcatagtagaattaatcaaaagcaagaaa
atggctggaagagctgtcttgttggcaggacctcctggaactggcaagacagctctggct
ctggctattgctcaggagctgggtagtaaggtccccttctgcccaatggtggggagtgaa
gtttactcaactgagatcaagaagacagaggtgctgatggagaacttccgcagggccatt
gggctgcgaataaaggagaccaaggaagtttatgaaggtgaagtcacagagctaactccg
tgtgagacagagaatcccatgggaggatatggcaaaaccattagccatgtgatcatagga
ctcaaaacagccaaaggaaccaaacagttgaaactggaccccagcatttttgaaagtttg
cagaaagagcgagtagaagctggagatgtgatttacattgaagccaacagtggggccgtg
aagaggcagggcaggtgtgatacctatgccacagaattcgaccttgaagctgaagagtat
gtccccttgccaaaaggggatgtgcacaaaaagaaagaaatcatccaagatgtgaccttg
catgacttggatgtggctaatgcgcggccccaggggggacaagatatcctgtccatgatg
ggccagctaatgaagccaaagaagacagaaatcacagacaaacttcgaggggagattaat
aaggtggtgaacaagtacatcgaccagggcattgctgagctggtcccgggtgtgctgttt
gttgatgaggtccacatgctggacattgagtgcttcacctacctgcaccgcgccctggag
tcttctatcgctcccatcgtcatctttgcatccaaccgaggcaactgtgtcatcagaggc
actgaggacatcacatcccctcacggcatccctcttgaccttctggaccgagtgatgata
atccggaccatgctgtatactccacaggaaatgaaacagatcattaaaatccgtgcccag
acggaaggaatcaacatcagtgaggaggcactgaaccacctgggggagattggcaccaag
accacactgaggtactcagtgcagctgctgaccccggccaacttgcttgctaaaatcaac
gggaaggacagcattgagaaagagcatgtcgaagagatcagtgaacttttctatgatgcc
aagtcctccgccaaaatcctggctgaccagcaggataagtacatgaagtga

DBGET integrated database retrieval system