KEGG   Homo sapiens (human): 8608Help
Entry
8608              CDS       T01001                                 

Gene name
RDH16, RODH-4, SDR9C8
Definition
(RefSeq) retinol dehydrogenase 16
  KO
K11154  retinol dehydrogenase 16 [EC:1.1.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00830  Retinol metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    8608 (RDH16)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     8608 (RDH16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 DUF1776 KR NAD_binding_10
Motif
Other DBs
NCBI-GeneID: 8608
NCBI-ProteinID: NP_003699
HGNC: 29674
Ensembl: ENSG00000139547
Vega: OTTHUMG00000170895
Pharos: O75452(Tbio)
UniProt: O75452 Q59FX7
Position
12q13.3
AA seq 317 aa AA seqDB search
MWLYLAVFVGLYYLLHWYRERQVLSHLRDKYVFITGCDSGFGKLLARQLDARGLRVLAAC
LTEKGAEQLRGQTSDRLETVTLDVTKTESVAAAAQWVKECVRDKGLWGLVNNAGISLPTA
PNELLTKQDFVTILDVNLLGVIDVTLSLLPLVRRARGRVVNVSSVMGRVSLFGGGYCISK
YGVEAFSDSLRRELSYFGVKVAMIEPGYFKTAVTSKERFLKSFLEIWDRSSPEVKEAYGE
KFVADYKKSAEQMEQKCTQDLSLVTNCMEHALIACHPRTRYSAGWDAKLLYLPMSYMPTF
LVDAIMYWVSPSPAKAL
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgtggctctacctggcggttttcgtgggcctgtactaccttctgcactggtaccgggag
aggcaggtgctgagccacctgagagataagtatgtgttcatcacgggctgtgactctggc
ttcgggaaactgctggccagacagctggatgcacgaggcttgcgggtgctggctgcatgt
ctgacggagaaaggagccgagcagctgaggggccagacttcagacaggctggagacggtg
accctggatgttaccaagacagagagcgttgctgcagccgcccagtgggtgaaggagtgc
gtgagagacaaaggactctggggcctggtgaataatgctggcatctccttgcccacggct
cccaatgagttgctcaccaagcaggacttcgtgaccatactggacgtgaacttgttgggg
gtgattgatgtgactctgagcctgctgcccttagtgaggagggccaggggccgtgtggtc
aacgtctccagtgtcatgggccgggtgtcactttttggtggaggctactgcatctccaag
tatggcgtggaagccttctctgactccctcaggagggaactctcctactttggggtgaag
gtggctatgattgaacctggctatttcaagactgctgtgaccagtaaggagagattctta
aagagcttcctggagatttgggaccggtccagtccagaggtcaaggaggcctatggcgag
aagtttgttgcagactataagaaatcagctgaacaaatggagcagaagtgcacacaggat
ctgtcgttggtgaccaactgcatggagcatgcgctgattgcctgccacccccgtactcgc
tactcagctggctgggatgccaagcttctctacctccccatgagctacatgcccaccttc
ctggtggatgccattatgtactgggtctctccaagcccggccaaggctctatga

DBGET integrated database retrieval system