KEGG   Homo sapiens (human): 8609
Entry
8609              CDS       T01001                                 

Gene name
KLF7, UKLF
Definition
(RefSeq) Kruppel like factor 7
  KO
K09207  krueppel-like factor 6/7
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    8609 (KLF7)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    8609 (KLF7)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_8
Other DBs
NCBI-GeneID: 8609
NCBI-ProteinID: NP_003700
OMIM: 604865
HGNC: 6350
Ensembl: ENSG00000118263
Vega: OTTHUMG00000132935
Pharos: O75840(Tbio)
UniProt: O75840 A0A024R3X8
Position
2q33.3
AA seq 302 aa
MDVLASYSIFQELQLVHDTGYFSALPSLEETWQQTCLELERYLQTEPRRISETFGEDLDC
FLHASPPPCIEESFRRLDPLLLPVEAAICEKSSAVDILLSRDKLLSETCLSLQPASSSLD
SYTAVNQAQLNAVTSLTPPSSPELSRHLVKTSQTLSAVDGTVTLKLVAKKAALSSVKVGG
VATAAAAVTAAGAVKSGQSDSDQGGLGAEACPENKKRVHRCQFNGCRKVYTKSSHLKAHQ
RTHTGEKPYKCSWEGCEWRFARSDELTRHYRKHTGAKPFKCNHCDRCFSRSDHLALHMKR
HI
NT seq 909 nt   +upstreamnt  +downstreamnt
atggacgtgttggctagttatagtatattccaggagctacaacttgtccacgacaccggc
tacttctcagctttaccatccctggaggagacctggcagcagacatgccttgaattggaa
cgctacctacagacggagccccggaggatctcagagacctttggtgaggacttggactgt
ttcctccacgcttcccctcccccgtgcattgaggaaagcttccgtcgcttagaccccctg
ctgctccccgtggaagcggccatctgtgagaagagctcggcagtggacatcttgctctct
cgggacaagttgctatctgagacctgcctcagcctccagccggccagctcttctctagac
agctacacagccgtcaaccaggcccagctcaacgcagtgacctcattaacgcccccatcg
tcccctgagctcagccgccatctggtcaaaacctcacaaactctctctgccgtggatggc
acggtgacgttgaaactggtggccaagaaggctgctctcagctccgtaaaggtgggaggg
gtcgcaacagctgcagcagccgtgacggctgcgggggccgttaagagtggacagagcgac
agtgaccaaggagggctgggggctgaagcatgtcccgaaaacaagaagagggttcaccgc
tgtcagtttaacgggtgccggaaagtttatacaaaaagctcccacttaaaggcccaccag
aggactcacacaggtgagaagccttataagtgctcatgggagggatgtgagtggcgtttt
gcacgaagcgatgagctcacgaggcactacaggaaacacacaggtgcaaagcccttcaaa
tgcaaccactgcgacaggtgtttttccaggtctgaccatcttgccctccacatgaagaga
catatctaa

DBGET integrated database retrieval system