KEGG   Homo sapiens (human): 8615
Entry
8615              CDS       T01001                                 

Gene name
USO1, P115, TAP, VDP
Definition
(RefSeq) USO1 vesicle transport factor
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Uso1_p115_head Arm_vescicular Uso1_p115_C ADIP Atx10homo_assoc DUF4407 Spc7
Other DBs
NCBI-GeneID: 8615
NCBI-ProteinID: NP_003706
OMIM: 603344
HGNC: 30904
Ensembl: ENSG00000138768
Vega: OTTHUMG00000160952
Pharos: O60763(Tbio)
UniProt: O60763
Structure
PDB: 
2W3C

Position
4q21.1
AA seq 962 aa
MNFLRGVMGGQSAGPQHTEAETIQKLCDRVASSTLLDDRRNAVRALKSLSKKYRLEVGIQ
AMEHLIHVLQTDRSDSEIIGYALDTLYNIISNEEEEEVEENSTRQSEDLGSQFTEIFIKQ
QENVTLLLSLLEEFDFHVRWPGVKLLTSLLKQLGPQVQQIILVSPMGVSRLMDLLADSRE
VIRNDGVLLLQALTRSNGAIQKIVAFENAFERLLDIISEEGNSDGGIVVEDCLILLQNLL
KNNNSNQNFFKEGSYIQRMKPWFEVGDENSGWSAQKVTNLHLMLQLVRVLVSPTNPPGAT
SSCQKAMFQCGLLQQLCTILMATGVPADILTETINTVSEVIRGCQVNQDYFASVNAPSNP
PRPAIVVLLMSMVNERQPFVLRCAVLYCFQCFLYKNQKGQGEIVSTLLPSTIDATGNSVS
AGQLLCGGLFSTDSLSNWCAAVALAHALQENATQKEQLLRVQLATSIGNPPVSLLQQCTN
ILSQGSKIQTRVGLLMLLCTWLSNCPIAVTHFLHNSANVPFLTGQIAENLGEEEQLVQGL
CALLLGISIYFNDNSLESYMKEKLKQLIEKRIGKENFIEKLGFISKHELYSRASQKPQPN
FPSPEYMIFDHEFTKLVKELEGVITKAIYKSSEEDKKEEEVKKTLEQHDNIVTHYKNMIR
EQDLQLEELRQQVSTLKCQNEQLQTAVTQQVSQIQQHKDQYNLLKIQLGKDNQHQGSYSE
GAQMNGIQPEEIGRLREEIEELKRNQELLQSQLTEKDSMIENMKSSQTSGTNEQSSAIVS
ARDSEQVAELKQELATLKSQLNSQSVEITKLQTEKQELLQKTEAFAKSVEVQGETETIIA
TKTTDVEGRLSALLQETKELKNEIKALSEERTAIKEQLDSSNSTIAILQTEKDKLELEIT
DSKKEQDDLLVLLADQDQKILSLKNKLKDLGHPVEEEDELESGDQEDEDDESEDPGKDLD
HI
NT seq 2889 nt   +upstreamnt  +downstreamnt
atgaatttcctccgcggggtaatggggggtcagagtgccggaccccagcacacagaagcc
gagacgattcaaaagctttgtgacagagtagcttcatctactttattggatgatcgaaga
aatgctgttcgtgctctcaaatcattatctaagaaataccgcttggaagtgggtatacaa
gctatggaacatcttattcatgttttacaaacagatcgttcagattctgaaataataggt
tatgctttggacacactatataatataatatctaatgaagaagaagaagaagtagaagaa
aattccacaagacagagtgaagatttgggaagccaatttacagaaattttcattaagcag
caggaaaatgtcactcttctgttatctttattggaggagtttgatttccatgtccgctgg
cctggtgtgaagcttcttacttctcttttaaaacaactagggcctcaggtgcaacaaatt
attttagtcagtcctatgggtgtttcaagattgatggacttactagcggattccagggaa
gttatacgtaatgatggcgtcttactactgcaggcactaacaagaagcaatggtgcaatc
cagaaaattgttgcttttgaaaatgctttcgagagactactggacattatttcagaggag
gggaacagtgatggaggtatagtagttgaagattgtttgattttgctccaaaacttatta
aaaaacaacaactccaatcaaaatttttttaaagaaggctcatatattcaacgtatgaaa
ccttggtttgaagttggagatgaaaattctggctggtctgcacagaaagtgaccaatcta
catctaatgctacagcttgttcgtgtattggtatctcccaccaaccctcctggtgctacc
agtagctgccagaaggctatgttccagtgtgggttattgcagcagctttgtactatccta
atggctactggggttcctgctgatatcctgactgagaccataaatactgtatcagaagtt
attcgaggctgccaagtaaaccaagactactttgcatctgtaaatgcaccttcaaaccca
ccaagaccggcaattgtagtacttctcatgtccatggttaatgaaaggcagccatttgtt
ttgcgctgtgctgttctctattgtttccagtgtttcttgtataaaaaccaaaaaggacaa
ggagaaatcgtgtcaacacttttaccttctaccattgatgcaacaggtaattcagtttca
gctggccagttattatgtggaggtttgttttctactgattcactttcaaactggtgtgct
gctgtggcccttgcccatgcgttgcaagaaaatgccacccagaaagaacagttgctcagg
gttcaacttgctacaagtattggcaaccctccagtttctttacttcaacagtgcaccaat
attctttcacagggaagcaaaatacaaacaagagttggattattaatgttgctttgtacc
tggctaagcaattgtcccattgcagtaacgcattttcttcacaattcagccaatgttcca
tttcttacaggacaaattgcagaaaatcttggagaagaagagcagttggtccaaggctta
tgtgcccttttgttgggcatttcgatttatttcaatgataactcacttgagagctacatg
aaagagaagctaaaacaactgattgagaagaggattggcaaagagaatttcatagagaaa
ctaggatttattagcaaacatgagttgtattccagagcatctcagaaaccccagccaaac
tttcccagtccagaatacatgatatttgatcatgagtttacgaagctggtaaaagaactt
gaaggtgttataactaaggctatttataagtccagtgaagaagataaaaaagaagaagag
gtgaaaaaaacattagaacagcatgacaatattgtgactcactacaaaaatatgattcga
gagcaggatctccaacttgaggaattaaggcagcaggtttctacattaaaatgtcaaaat
gaacagctccagacggcagtcacacagcaagtatcacagatccagcagcacaaagaccag
tataatcttcttaaaatacagctaggaaaagacaatcagcatcaaggttcttacagtgag
ggggctcagatgaatggcattcagccagaagaaattggtagattgcgagaagagatagaa
gaattaaaacgtaatcaggaacttttacaaagccagctgactgaaaaggactctatgatt
gaaaatatgaaatcttcccaaacatctggcacaaatgaacagtcttcagcaatagtttca
gctagagattctgaacaagttgcagaattaaaacaggaactggcaactttaaagtctcag
ttaaactcacaatctgtggagatcaccaaactacagacagaaaagcaggaactgttacag
aaaacagaagcgtttgcaaaatcagttgaggtacaaggagagaccgagactataatagcc
accaaaactactgatgtagaaggaagactgtcagcattattacaagagaccaaagagtta
aagaatgaaattaaagctctgtctgaggaaagaactgccattaaagagcagctggattca
tctaatagtaccattgccattttacaaactgagaaagacaaactagagttggaaattaca
gattctaaaaaagaacaagatgatctcttggtgctcttggccgatcaagatcagaaaata
ctgtcattgaagaataaactcaaggatcttggtcatccagttgaagaagaggatgaactt
gaatctggagaccaagaggatgaggatgatgaaagtgaagatcctggcaaggatctagat
catatctag

DBGET integrated database retrieval system