KEGG   Homo sapiens (human): 862Help
Entry
862               CDS       T01001                                 

Gene name
RUNX1T1, AML1-MTG8, AML1T1, CBFA2T1, CDR, ETO, MTG8, ZMYND2
Definition
(RefSeq) RUNX1 translocation partner 1
  KO
K10053  CBFA2/RNUX1 translocation partner 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    862 (RUNX1T1)
   05202 Transcriptional misregulation in cancer
    862 (RUNX1T1)
  09162 Cancers: Specific types
   05221 Acute myeloid leukemia
    862 (RUNX1T1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NHR2 TAFH zf-MYND DUF3731 Efg1 MAJIN
Motif
Other DBs
NCBI-GeneID: 862
NCBI-ProteinID: NP_001185555
OMIM: 133435
HGNC: 1535
Ensembl: ENSG00000079102
Vega: OTTHUMG00000164066
Pharos: Q06455(Tbio)
UniProt: Q06455
Structure
PDB: 

Position
8q21.3
AA seq 604 aa AA seqDB search
MISVKRNTWRALSLVIGDCRKKGNFEYCQDRTEKHSTMPDSPVDVKTQSRLTPPTMPPPP
TTQGAPRTSSFTPTTLTNGTSHSPTALNGAPSPPNGFSNGPSSSSSSSLANQQLPPACGA
RQLSKLKRFLTTLQQFGNDISPEIGERVRTLVLGLVNSTLTIEEFHSKLQEATNFPLRPF
VIPFLKANLPLLQRELLHCARLAKQNPAQYLAQHEQLLLDASTTSPVDSSELLLDVNENG
KRRTPDRTKENGFDREPLHSEHPSKRPCTISPGQRYSPNNGLSYQPNGLPHPTPPPPQHY
RLDDMAIAHHYRDSYRHPSHRDLRDRNRPMGLHGTRQEEMIDHRLTDREWAEEWKHLDHL
LNCIMDMVEKTRRSLTVLRRCQEADREELNYWIRRYSDAEDLKKGGGSSSSHSRQQSPVN
PDPVALDAHREFLHRPASGYVPEEIWKKAEEAVNEVKRQAMTELQKAVSEAERKAHDMIT
TERAKMERTVAEAKRQAAEDALAVINQQEDSSESCWNCGRKASETCSGCNTARYCGSFCQ
HKDWEKHHHICGQTLQAQQQGDTPAVSSSVTPNSGAGSPMDTPPAATPRSTTPGTPSTIE
TTPR
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgatatctgtcaaaagaaacacttggagagcactgagtttagtaataggtgactgccgg
aaaaaagggaactttgaatattgtcaagatcgtactgagaagcactccacaatgccagac
tcacctgtggatgtgaagacgcaatctaggctgactcctccaacaatgccacctccccca
actactcaaggagctccaagaaccagttcatttacaccgacaacgttaactaatggcacg
agccattctcctacagccttgaatggcgccccctcaccacccaatggcttcagcaatggg
ccttcctcttcttcctcctcctctctggctaatcaacagctgcccccagcctgtggtgcc
aggcaactcagcaagctgaaaaggttccttactaccctgcagcagtttggcaatgacatt
tcacccgagataggagaaagagttcgcaccctcgttctgggactagtgaactccactttg
acaattgaagaatttcattccaaactgcaagaagctactaacttcccactgagacctttt
gtcatcccatttttgaaggccaacttgcccctgctgcagcgtgagctcctccactgcgca
agactggccaaacagaaccctgcccagtacctcgcccagcatgaacagctgcttctggat
gccagcaccacctcacctgttgactcctcagagctgcttctcgatgtgaacgaaaacggg
aagaggcgaactccagacagaaccaaagaaaatggctttgacagagagcctttgcactca
gaacatccaagcaagcgaccatgcactattagcccaggccagcggtacagtccaaataac
ggcttatcctaccagcccaatggcctgcctcaccctaccccacctccacctcagcattac
cgtttggatgatatggccattgcccaccactacagggactcctatcgacaccccagccac
agggacctcagggacagaaacagacctatggggttgcatggcacacgtcaagaagaaatg
attgatcacagactaacagacagagaatgggcagaagagtggaaacatcttgaccatctg
ttaaactgcataatggacatggtagaaaaaacaaggcgatctctcaccgtactaaggcgg
tgtcaagaagcagaccgggaagaattgaattactggatccggcggtacagtgacgccgag
gacttaaaaaaaggtggcggcagtagcagcagccactctaggcagcagagtcccgtcaac
ccagacccagttgcactagacgcgcatcgggaattccttcacaggcctgcgtctggatac
gtgccagaggagatctggaagaaagctgaggaggccgtcaatgaggtgaagcgccaggcg
atgacggagctgcagaaggccgtgtctgaggcggagcggaaagcccacgacatgatcaca
acagagagggccaagatggagcgcacggtcgccgaggccaaacggcaggcggcggaggac
gcactggcagttatcaatcagcaggaggattcaagcgagagttgctggaattgtggccgt
aaagcgagtgaaacctgcagtggctgtaacacagcccgatactgtggctcattttgccag
cacaaagactgggagaagcaccatcacatctgtggacagaccctgcaggcccagcagcag
ggagacacacctgcagtcagctcctctgtcacgcccaacagcggggctgggagcccgatg
gacacaccaccagcagccactccgaggtcaaccaccccgggaaccccttccaccatagag
acaacccctcgctag

DBGET integrated database retrieval system