KEGG   Homo sapiens (human): 8623Help
Entry
8623              CDS       T01001                                 

Gene name
ASMTL, ASMTLX, ASMTLY, ASTML
Definition
(RefSeq) acetylserotonin O-methyltransferase like
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_2 Maf Dimerisation2 Methyltransf_23 Methyltransf_25 Methyltransf_11 Methyltransf_12 FeoC
Motif
Other DBs
NCBI-GeneID: 8623
NCBI-ProteinID: NP_004183
OMIM: 300162 400011
HGNC: 751
Ensembl: ENSG00000169093
Vega: OTTHUMG00000021057
Pharos: O95671(Tdark)
UniProt: O95671 B3KM43
Structure
PDB: 

Position
Xp22.33 and Yp11.2
AA seq 621 aa AA seqDB search
MVLCPVIGKLLHKRVVLASASPRRQEILSNAGLRFEVVPSKFKEKLDKASFATPYGYAME
TAKQKALEVANRLYQKDLRAPDVVIGADTIVTVGGLILEKPVDKQDAYRMLSRLSGREHS
VFTGVAIVHCSSKDHQLDTRVSEFYEETKVKFSELSEELLWEYVHSGEPMDKAGGYGIQA
LGGMLVESVHGDFLNVVGFPLNHFCKQLVKLYYPPRPEDLRRSVKHDSIPAADTFEDLSD
VEGGGSEPTQRDAGSRDEKAEAGEAGQATAEAECHRTRETLPPFPTRLLELIEGFMLSKG
LLTACKLKVFDLLKDEAPQKAADIASKVDASACGMERLLDICAAMGLLEKTEQGYSNTET
ANVYLASDGEYSLHGFIMHNNDLTWNLFTYLEFAIREGTNQHHRALGKKAEDLFQDAYYQ
SPETRLRFMRAMHGMTKLTACQVATAFNLSRFSSACDVGGCTGALARELAREYPRMQVTV
FDLPDIIELAAHFQPPGPQAVQIHFAAGDFFRDPLPSAELYVLCRILHDWPDDKVHKLLS
RVAESCKPGAGLLLVETLLDEEKRVAQRALMQSLNMLVQTEGKERSLGEYQCLLELHGFH
QVQVVHLGGVLDAILATKVAP
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atggtgctgtgcccggtgattgggaagctgctgcacaagcgcgtggtgctggccagcgcc
tccccacgccgtcaggagatcctcagcaacgcgggtctcaggtttgaggtggtcccctcc
aagtttaaagagaagctggacaaagcctccttcgctactccgtatgggtacgccatggag
accgccaagcagaaggccctggaggtggccaaccggctgtaccagaaagacctgcgggcc
cccgacgtggtcattggagcggacacgatcgtgacagtcggggggctgattctggagaag
ccggtggacaagcaggacgcctacaggatgctgtcccggttgagtgggagagaacacagc
gtgttcacaggtgtcgcgatcgtccactgctccagcaaagaccatcagctggacaccagg
gtctcggaattctacgaggaaacgaaggtgaagttctcggagctgtccgaggagctgctc
tgggaatacgtccacagcggggagcccatggacaaagctggcggctacgggatccaggcc
ctgggcggcatgctggtggagtccgtacacggggactttctgaacgtggtgggattcccg
ctgaaccacttctgcaagcagctggtgaagctctactacccgccccgtccggaggacctg
cggcggagtgtcaagcacgactccatcccggccgcggacaccttcgaagacctcagtgac
gtggaggggggcggctcggagcccactcagagggacgcgggcagccgcgatgagaaggcc
gaggcgggagaggcgggacaggccacggcagaggctgagtgtcacaggactcgggagacc
ctgcctccgttcccgacacgcctcctggagctgattgagggctttatgctatccaagggc
ctgctcaccgcttgcaaactgaaggtgttcgatttgttaaaagatgaagcaccccagaag
gctgcggatattgccagcaaagtggacgcctctgcgtgtggaatggagaggcttctggac
atctgtgctgccatggggctcctggagaagacagagcaaggttacagtaacacagagaca
gcgaacgtctacctggcatcggatggcgaatactctctgcacggcttcatcatgcacaat
aatgacctcacatggaacctctttacatacctggagtttgccatccgagagggaacaaac
cagcaccacagggcgttggggaagaaggcggaagatctgttccaggatgcgtactaccag
agcccggagacgcggctgaggttcatgcgggccatgcacggcatgacgaagctgactgcg
tgccaggtggccacggccttcaatctgtcccgcttctcctccgcctgcgacgtgggaggc
tgcacgggtgcactggcccgagagctggcccgtgagtaccctcgtatgcaggtgactgtg
tttgacctcccagacattatcgagctggccgcccacttccaaccccccggaccgcaggca
gtgcagatccacttcgcagcaggtgactttttcagggaccccctccccagcgctgagctg
tacgtcctgtgccggatcctgcatgactggccagacgacaaagtccacaagttactcagc
agggtcgccgagagctgcaagccaggggccggcctgctgctggtggagacgctcctggat
gaggagaagagggtggcgcagcgcgccctgatgcagtcactgaacatgctggtgcagact
gaaggcaaggagcggagcctgggcgagtatcagtgcttgctggagctgcacggcttccac
caggtgcaggtggtgcacttggggggtgtcctggatgccatcttggccaccaaagtggcc
ccctga

DBGET integrated database retrieval system