KEGG   Homo sapiens (human): 863Help
Entry
863               CDS       T01001                                 

Gene name
CBFA2T3, ETO2, MTG16, MTGR2, RUNX1T3, ZMYND4
Definition
(RefSeq) CBFA2/RUNX1 partner transcriptional co-repressor 3
  KO
K22752  CBFA2/RUNX1 translocation partner 3
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99973 Transcription
    863 (CBFA2T3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NHR2 TAFH zf-MYND Efg1
Motif
Other DBs
NCBI-GeneID: 863
NCBI-ProteinID: NP_005178
OMIM: 603870
HGNC: 1537
Ensembl: ENSG00000129993
Vega: OTTHUMG00000137864
Pharos: O75081(Tbio)
UniProt: O75081
Position
16q24.3
AA seq 653 aa AA seqDB search
MPASRLRDRAASSASGSTCGSMSQTHPVLESGLLASAGCSAPRGPRKGGPAPVDRKAKAS
AMPDSPAEVKTQPRSTPPSMPPPPPAASQGATRPPSFTPHTHREDGPATLPHGRFHGCLK
WSMVCLLMNGSSHSPTAINGAPCTPNGFSNGPATSSTASLSTQHLPPACGARQLSKLKRF
LTTLQQFGSDISPEIGERVRTLVLGLVNSTLTIEEFHSKLQEATNFPLRPFVIPFLKANL
PLLQRELLHCARLAKQTPAQYLAQHEQLLLDASASSPIDSSELLLEVNENGKRRTPDRTK
ENGSDRDPLHPEHLSKRPCTLNPAQRYSPSNGPPQPTPPPHYRLEDIAMAHHFRDAYRHP
DPRELRERHRPLVVPGSRQEEVIDHKLTEREWAEEWKHLNNLLNCIMDMVEKTRRSLTVL
RRCQEADREELNHWARRYSDAEDTKKGPAPAAARPRSSSAGPEGPQLDVPREFLPRTLTG
YVPEDIWRKAEEAVNEVKRQAMSELQKAVSDAERKAHELITTERAKMERALAEAKRQASE
DALTVINQQEDSSESCWNCGRKASETCSGCNAARYCGSFCQHRDWEKHHHVCGQSLQGPT
AVVADPVPGPPEAAHSLGPSLPVGAASPSEAGSAGPSRPGSPSPPGPLDTVPR
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgccggcttcaagactgagggacagggcagccagttcagcctcgggatccacctgtggc
tccatgtcccagacgcaccctgtgctggagagcggcctcctggcatctgccggctgctcc
gcaccccggggtcccaggaagggcggcccagccccagtggacaggaaagctaaggcctca
gcgatgccggactccccagcggaggtgaagacgcagccccggtccacaccccccagcatg
ccgcccccaccgcctgccgcatcccagggggccacacgccccccctccttcacgccacac
acacatcgagaggacgggcctgcgacgctgccccacggccgttttcatggctgcttaaaa
tggtctatggtctgtctcttgatgaacggcagcagccactcaccaacagccatcaatggt
gcaccgtgcacacccaacggcttcagcaatggcccggccacctcgtccacagcctccttg
tccacacagcacctgcccccagcctgcggggcccggcagctcagcaagctcaagcgcttc
ctcaccacactgcagcagtttggcagcgacatctccccagagattggggagcgcgtgcgc
acactggtgctgggcctggtgaactcgacattgacgatcgaggagtttcattccaagctt
caggaggccaccaacttccctctgcggccgtttgtcattcccttcctgaaggcaaacctg
cccttgctgcagcgggagctcctgcactgtgcacgcctggccaagcagacgcccgcccag
tacttggcccagcatgagcagctcctgctggacgccagcgcctcctcccccatcgactcc
tcagagctgctactggaagtcaacgagaacggcaagaggaggacgcccgacaggaccaaa
gagaacgggtcagaccgcgacccgctgcaccccgagcacctcagcaaacggccatgcacc
ctgaaccctgcccagcgctacagccccagcaacgggccaccgcagcccacaccgccgccg
cactaccgcctggaggacatagccatggcccaccacttccgagatgcctaccgccaccca
gacccccgggagctacgagagcgccatcggccgcttgtggtgcctgggtcccggcaggaa
gaagtgatcgaccacaagctcacagagcgtgagtgggcagaagagtggaagcacctcaac
aacctcctgaactgcatcatggacatggtggagaagacgcggcgctcgctcacggtgctg
cgcaggtgccaggaggccgaccgcgaggagctcaaccactgggcgcggcgctacagcgac
gccgaggacacaaagaagggccccgctcccgccgcggcccggccccgcagcagctccgcc
ggtcccgaagggcctcagctagacgtgcctcgcgagttcctgccgaggaccctcaccggc
tacgtgcctgaggacatctggaggaaggctgaagaggccgtgaatgaggtgaagcggcag
gccatgtcggagctgcagaaagccgtgtcggacgcggagcgcaaagcgcacgagctcatc
accacggagcgtgccaagatggagcgggccctggccgaggcgaagcggcaggcctccgag
gacgccctgacggtcatcaaccagcaggaggactccagcgagagctgctggaactgcggg
cggaaagccagtgagacgtgcagcggctgcaacgcggcacgctactgcgggtccttctgc
cagcatcgggactgggagaagcatcaccacgtgtgtggccagagcctgcagggccccaca
gccgtggtggccgacccggtgcctggaccgcccgaagccgcccacagcctgggcccctcc
ctgcctgtgggtgctgccagccccagcgaagccggctctgcggggccttctcgccccggc
tcccccagcccacctggcccactggacaccgtgccccgctga

DBGET integrated database retrieval system