KEGG   Homo sapiens (human): 8634
Entry
8634              CDS       T01001                                 
Symbol
RTCA, RPC, RTC1, RTCD1
Name
(RefSeq) RNA 3'-terminal phosphate cyclase
  KO
K01974  RNA 3'-terminal phosphate cyclase (ATP) [EC:6.5.1.4]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    8634 (RTCA)
Enzymes [BR:hsa01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.4  RNA 3'-terminal-phosphate cyclase (ATP)
     8634 (RTCA)
SSDB
Motif
Pfam: RTC RTC_insert
Other DBs
NCBI-GeneID: 8634
NCBI-ProteinID: NP_003720
OMIM: 611286
HGNC: 17981
Ensembl: ENSG00000137996
Pharos: O00442(Tbio)
UniProt: O00442
Position
1:100266216..100292769
AA seq 366 aa
MAGPRVEVDGSIMEGGGQILRVSTALSCLLGLPLRVQKIRAGRSTPGLRPQHLSGLEMIR
DLCDGQLEGAEIGSTEITFTPEKIKGGIHTADTKTAGSVCLLMQVSMPCVLFAASPSELH
LKGGTNAEMAPQIDYTVMVFKPIVEKFGFIFNCDIKTRGYYPKGGGEVIVRMSPVKQLNP
INLTERGCVTKIYGRAFVAGVLPFKVAKDMAAAAVRCIRKEIRDLYVNIQPVQEPKDQAF
GNGNGIIIIAETSTGCLFAGSSLGKRGVNADKVGIEAAEMLLANLRHGGTVDEYLQDQLI
VFMALANGVSRIKTGPVTLHTQTAIHFAEQIAKAKFIVKKSEDEEDAAKDTYIIECQGIG
MTNPNL
NT seq 1101 nt   +upstreamnt  +downstreamnt
atggcggggccgcgggtggaggtcgatggcagcatcatggaagggggcggccagatcctg
agagtctctacggccttgagctgtctcctaggcctccccttgcgggtgcagaagatccga
gccggccggagcacgccaggcctgaggcctcaacatttatctggactggaaatgattcga
gatttgtgtgatgggcaactggagggggcagaaattggctcaacagaaataacctttaca
ccagagaagatcaaaggtggaatccacacagcagataccaagacagcagggagtgtgtgc
ctcttgatgcaggtctcaatgccgtgtgttctctttgctgcttctccatcagaacttcat
ttgaaaggtggaactaatgctgaaatggcaccacagatcgattatacagtgatggtcttc
aagccaattgttgaaaaatttggtttcatatttaattgtgacattaaaacaaggggatat
tacccaaaagggggtggtgaagtgattgttcgaatgtcaccagttaaacaattgaaccct
ataaatttaactgagcgtggctgtgtgactaagatatatggaagagctttcgttgctggt
gttttgccatttaaagtagcaaaagatatggcagcggcagcagttagatgcatcagaaag
gagatccgggatttgtatgttaacatccagcctgttcaagaacctaaagaccaagcattt
ggcaatggaaatggaataataattattgctgagacctccactggctgtttgtttgctgga
tcatcgcttggtaaacgaggtgtaaatgcagacaaagttggaattgaagctgccgaaatg
ctattagcaaatcttagacatggtggtactgtggatgagtatctgcaagaccagctgatt
gttttcatggcattagccaatggagtttccagaataaaaacaggaccagttacactccat
acgcaaaccgcgatacattttgctgaacaaatagcaaaggctaaatttattgtgaagaaa
tcagaagatgaagaagacgccgctaaagatacttatattattgaatgccaaggaattggg
atgacaaatccaaatctatag

DBGET integrated database retrieval system