KEGG   Homo sapiens (human): 8639
Entry
8639              CDS       T01001                                 

Gene name
AOC3, HPAO, SSAO, VAP-1, VAP1
Definition
(RefSeq) amine oxidase copper containing 3
  KO
K00276  primary-amine oxidase [EC:1.4.3.21]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00260  Glycine, serine and threonine metabolism
hsa00350  Tyrosine metabolism
hsa00360  Phenylalanine metabolism
hsa00410  beta-Alanine metabolism
hsa01100  Metabolic pathways
Drug target
Hydralazine (DG00261): D04458 D08044
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    8639 (AOC3)
   00350 Tyrosine metabolism
    8639 (AOC3)
   00360 Phenylalanine metabolism
    8639 (AOC3)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    8639 (AOC3)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.21  primary-amine oxidase
     8639 (AOC3)
SSDB
Motif
Pfam: Cu_amine_oxid Cu_amine_oxidN2 Cu_amine_oxidN3 DUF1965
Other DBs
NCBI-GeneID: 8639
NCBI-ProteinID: NP_003725
OMIM: 603735
HGNC: 550
Ensembl: ENSG00000131471
Vega: OTTHUMG00000180656
Pharos: Q16853(Tchem)
UniProt: Q16853 Q9UEU7
Structure
PDB: 

Position
17q21.31
AA seq 763 aa
MNQKTILVLLILAVITIFALVCVLLVGRGGDGGEPSQLPHCPSVSPSAQPWTHPGQSQLF
ADLSREELTAVMRFLTQRLGPGLVDAAQARPSDNCVFSVELQLPPKAAALAHLDRGSPPP
AREALAIVFFGRQPQPNVSELVVGPLPHPSYMRDVTVERHGGPLPYHRRPVLFQEYLDID
QMIFNRELPQASGLLHHCCFYKHRGRNLVTMTTAPRGLQSGDRATWFGLYYNISGAGFFL
HHVGLELLVNHKALDPARWTIQKVFYQGRYYDSLAQLEAQFEAGLVNVVLIPDNGTGGSW
SLKSPVPPGPAPPLQFYPQGPRFSVQGSRVASSLWTFSFGLGAFSGPRIFDVRFQGERLV
YEISLQEALAIYGGNSPAAMTTRYVDGGFGMGKYTTPLTRGVDCPYLATYVDWHFLLESQ
APKTIRDAFCVFEQNQGLPLRRHHSDLYSHYFGGLAETVLVVRSMSTLLNYDYVWDTVFH
PSGAIEIRFYATGYISSAFLFGATGKYGNQVSEHTLGTVHTHSAHFKVDLDVAGLENWVW
AEDMVFVPMAVPWSPEHQLQRLQVTRKLLEMEEQAAFLVGSATPRYLYLASNHSNKWGHP
RGYRIQMLSFAGEPLPQNSSMARGFSWERYQLAVTQRKEEEPSSSSVFNQNDPWAPTVDF
SDFINNETIAGKDLVAWVTAGFLHIPHAEDIPNTVTVGNGVGFFLRPYNFFDEDPSFYSA
DSIYFRGDQDAGACEVNPLACLPQAAACAPDLPAFSHGGFSHN
NT seq 2292 nt   +upstreamnt  +downstreamnt
atgaaccagaagacaatcctcgtgctcctcattctggccgtcatcaccatctttgccttg
gtttgtgtcctgctggtgggcaggggtggagatgggggtgaacccagccagcttccccat
tgcccctctgtatctcccagtgcccagccttggacacaccctggccagagccagctgttt
gcagacctgagccgagaggagctgacggctgtgatgcgctttctgacccagcggctgggg
ccagggctggtggatgcagcccaggcccggccctcggacaactgtgtcttctcagtggag
ttgcagctgcctcccaaggctgcagccctggctcacttggacagggggagccccccacct
gcccgggaggcactggccatcgtcttctttggcaggcaaccccagcccaacgtgagtgag
ctggtggtggggccactgcctcacccctcctacatgcgggacgtgactgtggagcgtcat
ggaggccccctgccctatcaccgacgccccgtgctgttccaagagtacctggacatagac
cagatgatcttcaacagagagctgccccaggcttctgggcttctccaccactgttgcttc
tacaagcaccggggacggaacctggtgacaatgaccacggctccccgtggtctgcaatca
ggggaccgggccacctggtttggcctctactacaacatctcgggcgctgggttcttcctg
caccacgtgggcttggagctgctagtgaaccacaaggcccttgaccctgcccgctggact
atccagaaggtgttctatcaaggccgctactacgacagcctggcccagctggaggcccag
tttgaggccggcctggtgaatgtggtgctgatcccagacaatggcacaggtgggtcctgg
tccctgaagtcccctgtgcccccgggtccagctccccctctacagttctatccccaaggc
ccccgcttcagtgtccagggaagtcgagtggcctcctcactgtggactttctcctttggc
ctcggagcattcagtggcccaaggatctttgacgttcgcttccaaggagaaagactagtt
tatgagataagcctccaagaggccttggccatctatggtggaaattccccagcagcaatg
acgacccgctatgtggatggaggctttggcatgggcaagtacaccacgcccctgacccgt
ggggtggactgcccctacttggccacctacgtggactggcacttccttttggagtcccag
gcccccaagacaatacgtgatgccttttgtgtgtttgaacagaaccagggcctccccctg
cggcgacaccactcagatctctactcgcactactttgggggtcttgcggaaacggtgctg
gtcgtcagatctatgtccaccttgctcaactatgactatgtgtgggatacggtcttccac
cccagtggggccatagaaatacgattctatgccacgggctacatcagctcggcattcctc
tttggtgctactgggaagtacgggaaccaagtgtcagagcacaccctgggcacggtccac
acccacagcgcccacttcaaggtggatctggatgtagcaggactggagaactgggtctgg
gccgaggatatggtctttgtccccatggctgtgccctggagccctgagcaccagctgcag
aggctgcaggtgacccggaagctgctggagatggaggagcaggccgccttcctcgtggga
agcgccacccctcgctacctgtacctggccagcaaccacagcaacaagtggggtcacccc
cggggctaccgcatccagatgctcagctttgctggagagccgctgccccaaaacagctcc
atggcgagaggcttcagctgggagaggtaccagctggctgtgacccagcggaaggaggag
gagcccagtagcagcagcgttttcaatcagaatgacccttgggcccccactgtggatttc
agtgacttcatcaacaatgagaccattgctggaaaggatttggtggcctgggtgacagct
ggttttctgcatatcccacatgcagaggacattcctaacacagtgactgtggggaacggc
gtgggcttcttcctccgaccctataacttctttgacgaagacccctccttctactctgcc
gactccatctacttccgaggggaccaggatgctggggcctgcgaggtcaaccccctagct
tgcctgccccaggctgctgcctgtgcccccgacctccctgccttctcccacgggggcttc
tctcacaactag

DBGET integrated database retrieval system