KEGG   Homo sapiens (human): 864Help
Entry
864               CDS       T01001                                 

Gene name
RUNX3, AML2, CBFA3, PEBP2aC
Definition
(RefSeq) runt related transcription factor 3
  KO
K09279  runt-related transcription factor 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04658  Th1 and Th2 cell differentiation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04658 Th1 and Th2 cell differentiation
    864 (RUNX3)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   Runt
    864 (RUNX3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Runt RunxI
Motif
Other DBs
NCBI-GeneID: 864
NCBI-ProteinID: NP_004341
OMIM: 600210
HGNC: 10473
Ensembl: ENSG00000020633
Vega: OTTHUMG00000003316
Pharos: Q13761(Tbio)
UniProt: Q13761
Position
1p36.11
AA seq 415 aa AA seqDB search
MRIPVDPSTSRRFTPPSPAFPCGGGGGKMGENSGALSAQAAVGPGGRARPEVRSMVDVLA
DHAGELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGDVPDGTVVTVMAGNDENYSAE
LRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPTQVATYHRAIKVTVDGPREP
RRHRQKLEDQTKPFPDRFGDLERLRMRVTPSTPSPRGSLSTTSHFSSQPQTPIQGTSELN
PFSDPRQFDRSFPTLPTLTESRFPDPRMHYPGAMSAAFPYSATPSGTSISSLSVAGMPAT
SRFHHTYLPPPYPGAPQNQSGPFQANPSPYHLYYGTSSGSYQFSMVAGSSSGGDRSPTRM
LASCTSSAASVAAGNLMNPSLGGQSDGVEADGSHSNSPTALSTPGRMDEAVWRPY
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgcgtattcccgtagacccaagcaccagccgccgcttcacacctccctccccggccttc
ccctgcggcggcggcggcggcaagatgggcgagaacagcggcgcgctgagcgcgcaggcg
gccgtggggcccggagggcgcgcccggcccgaggtgcgctcgatggtggacgtgctggcg
gaccacgcaggcgagctcgtgcgcaccgacagccccaacttcctctgctccgtgctgccc
tcgcactggcgctgcaacaagacgctgcccgtcgccttcaaggtggtggcattgggggac
gtgccggatggtacggtggtgactgtgatggcaggcaatgacgagaactactccgctgag
ctgcgcaatgcctcggccgtcatgaagaaccaggtggccaggttcaacgaccttcgcttc
gtgggccgcagtgggcgagggaagagtttcaccctgaccatcactgtgttcaccaacccc
acccaagtggcgacctaccaccgagccatcaaggtgaccgtggacggaccccgggagccc
agacggcaccggcagaagctggaggaccagaccaagccgttccctgaccgctttggggac
ctggaacggctgcgcatgcgggtgacaccgagcacacccagcccccgaggctcactcagc
accacaagccacttcagcagccagccccagaccccaatccaaggcacctcggaactgaac
ccattctccgacccccgccagtttgaccgctccttccccacgctgccaaccctcacggag
agccgcttcccagaccccaggatgcattatcccggggccatgtcagctgccttcccctac
agcgccacgccctcgggcacgagcatcagcagcctcagcgtggcgggcatgccggccacc
agccgcttccaccatacctacctcccgccaccctacccgggggccccgcagaaccagagc
gggcccttccaggccaacccgtccccctaccacctctactacgggacatcctctggctcc
taccagttctccatggtggccggcagcagcagtgggggcgaccgctcacctacccgcatg
ctggcctcttgcaccagcagcgctgcctctgtcgccgccggcaacctcatgaaccccagc
ctgggcggccagagtgatggcgtggaggccgacggcagccacagcaactcacccacggcc
ctgagcacgccaggccgcatggatgaggccgtgtggcggccctactga

DBGET integrated database retrieval system