KEGG   Homo sapiens (human): 8642Help
Entry
8642              CDS       T01001                                 

Gene name
DCHS1, CDH19, CDH25, CDHR6, FIB1, MVP2, PCDH16, VMLDS1
Definition
(RefSeq) dachsous cadherin-related 1
  KO
K16507  protocadherin-16/23
Organism
hsa  Homo sapiens (human)
Pathway
hsa04392  Hippo signaling pathway - multiple species
Disease
H01393  Van Maldergem syndrome
H01868  Mitral valve prolapse
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04392 Hippo signaling pathway - multiple species
    8642 (DCHS1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:hsa04515]
    8642 (DCHS1)
Cell adhesion molecules [BR:hsa04515]
 Cadherins
  Cadherin related
   8642 (DCHS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cadherin Cadherin_3 Cadherin_pro Cadherin_4 Big_9
Motif
Other DBs
NCBI-GeneID: 8642
NCBI-ProteinID: NP_003728
OMIM: 603057
HGNC: 13681
Ensembl: ENSG00000166341
Vega: OTTHUMG00000133398
Pharos: Q96JQ0(Tbio)
UniProt: Q96JQ0
Position
11p15.4
AA seq 3298 aa AA seqDB search
MQKELGIVPSCPGMKSPRPHLLLPLLLLLLLLLGAGVPGAWGQAGSLDLQIDEEQPAGTL
IGDISAGLPAGTAAPLMYFISAQEGSGVGTDLAIDEHSGVVRTARVLDREQRDRYRFTAV
TPDGATVEVTVRVADINDHAPAFPQARAALQVPEHTAFGTRYPLEPARDADAGRLGTQGY
ALSGDGAGETFRLETRPGPDGTPVPELVVTGELDRENRSHYMLQLEAYDGGSPPRRAQAL
LDVTLLDINDHAPAFNQSRYHAVVSESLAPGSPVLQVFASDADAGVNGAVTYEINRRQSE
GDGPFSIDAHTGLLQLERPLDFEQRRVHELVVQARDGGAHPELGSAFVTVHVRDANDNQP
SMTVIFLSADGSPQVSEAAPPGQLVARISVSDPDDGDFAHVNVSLEGGEGHFALSTQDSV
IYLVCVARRLDREERDAYNLRVTATDSGSPPLRAEAAFVLHVTDVNDNAPAFDRQLYRPE
PLPEVALPGSFVVRVTARDPDQGTNGQVTYSLAPGAHTHWFSIDPTSGIITTAASLDYEL
EPQPQLIVVATDGGLPPLASSATVSVALQDVNDNEPQFQRTFYNASLPEGTQPGTCFLQV
TATDADSGPFGLLSYSLGAGLGSSGSPPFRIDAHSGDVCTTRTLDRDQGPSSFDFTVTAV
DGGGLKSMVYVKVFLSDENDNPPQFYPREYAASISAQSPPGTAVLRLRAHDPDQGSHGRL
SYHILAGNSPPLFTLDEQSGLLTVAWPLARRANSVVQLEIGAEDGGGLQAEPSARVDISI
VPGTPTPPIFEQLQYVFSVPEDVAPGTSVGIVQAHNPPGRLAPVTLSLSGGDPRGLFSLD
AVSGLLQTLRPLDRELLGPVLELEVRAGSGVPPAFAVARVRVLLDDVNDNSPAFPAPEDT
VLLPPNTAPGTPIYTLRALDPDSGVNSRVTFTLLAGGGGAFTVDPTTGHVRLMRPLGPSG
GPAHELELEARDGGSPPRTSHFRLRVVVQDVGTRGLAPRFNSPTYRVDLPSGTTAGTQVL
QVQAQAPDGGPITYHLAAEGASSPFGLEPQSGWLWVRAALDREAQELYILKVMAVSGSKA
ELGQQTGTATVRVSILNQNEHSPRLSEDPTFLAVAENQPPGTSVGRVFATDRDSGPNGRL
TYSLQQLSEDSKAFRIHPQTGEVTTLQTLDREQQSSYQLLVQVQDGGSPPRSTTGTVHVA
VLDLNDNSPTFLQASGAAGGGLPIQVPDRVPPGTLVTTLQAKDPDEGENGTILYTLTGPG
SELFSLHPHSGELLTAAPLIRAERPHYVLTLSAHDQGSPPRSASLQLLVQVLPSARLAEP
PPDLAERDPAAPVPVVLTVTAAEGLRPGSLLGSVAAPEPAGVGALTYTLVGGADPEGTFA
LDAASGRLYLARPLDFEAGPPWRALTVRAEGPGGAGARLLRVQVQVQDENEHAPAFARDP
LALALPENPEPGAALYTFRASDADGPGPNSDVRYRLLRQEPPVPALRLDARTGALSAPRG
LDRETTPALLLLVEATDRPANASRRRAARVSARVFVTDENDNAPVFASPSRVRLPEDQPP
GPAALHVVARDPDLGEAARVSYRLASGGDGHFRLHSSTGALSVVRPLDREQRAEHVLTVV
ASDHGSPPRSATQVLTVSVADVNDEAPTFQQQEYSVLLRENNPPGTSLLTLRATDPDVGA
NGQVTYGGVSSESFSLDPDTGVLTTLRALDREEQEEINLTVYAQDRGSPPQLTHVTVRVA
VEDENDHAPTFGSAHLSLEVPEGQDPQTLTMLRASDPDVGANGQLQYRILDGDPSGAFVL
DLASGEFGTMRPLDREVEPAFQLRIEARDGGQPALSATLLLTVTVLDANDHAPAFPVPAY
SVEVPEDVPAGTLLLQLQAHDPDAGANGHVTYYLGAGTAGAFLLEPSSGELRTAAALDRE
QCPSYTFSVSAVDGAAAGPLSTTVSVTITVRDVNDHAPTFPTSPLRLRLPRPGPSFSTPT
LALATLRAEDRDAGANASILYRLAGTPPPGTTVDSYTGEIRVARSPVALGPRDRVLFIVA
TDLGRPARSATGVIIVGLQGEAERGPRFPRASSEATIRENAPPGTPIVSPRAVHAGGTNG
PITYSILSGNEKGTFSIQPSTGAITVRSAEGLDFEVSPRLRLVLQAESGGAFAFTVLTLT
LQDANDNAPRFLRPHYVAFLPESRPLEGPLLQVEADDLDQGSGGQISYSLAASQPARGLF
HVDPTTGTITTTAILDREIWAETRLVLMATDRGSPALVGSATLTVMVIDTNDNRPTIPQP
WELRVSEDALLGSEIAQVTGNDVDSGPVLWYVLSPSGPQDPFSVGRYGGRVSLTGPLDFE
QCDRYQLQLLAHDGPHEGRANLTVLVEDVNDNAPAFSQSLYQVMLLEHTPPGSAILSVSA
TDRDSGANGHISYHLASPADGFSVDPNNGTLFTIVGTVALGHDGSGAVDVVLEARDHGAP
GRAARATVHVQLQDQNDHAPSFTLSHYRVAVTEDLPPGSTLLTLEATDADGSRSHAAVDY
SIISGNWGRVFQLEPRLAEAGESAGPGPRALGCLVLLEPLDFESLTQYNLTVAAADRGQP
PQSSVVPVTVTVLDVNDNPPVFTRASYRVTVPEDTPVGAELLHVEASDADPGPHGLVRFT
VSSGDPSGLFELDESSGTLRLAHALDCETQARHQLVVQAADPAGAHFALAPVTIEVQDVN
DHGPAFPLNLLSTSVAENQPPGTLVTTLHAIDGDAGAFGRLRYSLLEAGPGPEGREAFAL
NSSTGELRARVPFDYEHTESFRLLVGAADAGNLSASVTVSVLVTGEDEYDPVFLAPAFHF
QVPEGARRGHSLGHVQATDEDGGADGLVLYSLATSSPYFGINQTTGALYLRVDSRAPGSG
TATSGGGGRTRREAPRELRLEVIARGPLPGSRSATVPVTVDITHTALGLAPDLNLLLVGA
VAASLGVVVVLALAALVLGLVRARSRKAEAAPGPMSQAAPLASDSLQKLGREPPSPPPSE
HLYHQTLPSYGGPGAGGPYPRGGSLDPSHSSGRGSAEAAEDDEIRMINEFPRVASVASSL
AARGPDSGIQQDADGLSDTSCEPPAPDTWYKGRKAGLLLPGAGATLYREEGPPATATAFL
GGCGLSPAPTGDYGFPADGKPCVAGALTAIVAGEEELRGSYNWDYLLSWCPQFQPLASVF
TEIARLKDEARPCPPAPRIDPPPLITAVAHPGAKSVPPKPANTAAARAIFPPASHRSPIS
HEGSLSSAAMSPSFSPSLSPLAARSPVVSPFGVAQGPSASALSAESGLEPPDDTELHI
NT seq 9897 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaggagctgggcattgtgccttcctgccctggcatgaagagccccaggccccac
ctcctgctaccattgctgctgctgctgctgctgctgctgggggctggggtgccaggtgcc
tggggtcaggctgggagcctggacttgcagattgatgaggagcagccagcgggtacactg
attggcgacatcagtgcggggcttccggcaggcacggcagctcctctcatgtacttcatc
tctgcccaagagggcagcggcgtgggcacagacctggccattgacgaacacagtggggtc
gtccgtacagcccgtgtcttggaccgtgagcagcgggaccgctaccgcttcactgcagtc
actcctgatggtgccaccgtagaagttacagtgcgagtggctgacatcaacgaccatgct
ccagccttcccacaggctcgggctgccctgcaggtacctgagcatacagcttttggcacc
cgctacccactggagcctgctcgtgatgcagatgctgggcgtctgggaacccagggctat
gcgctatctggtgatggggctggagagaccttccggctggagacacgccccggtccagat
gggactccagtacctgagctggtagttactggggaactggaccgagagaaccgctcacac
tatatgctacagctggaggcctatgatggtggttcacccccccggagggcccaggccctg
ctggacgtgacactgctggacatcaatgaccatgccccggctttcaatcagagccgctac
catgctgtggtgtctgagagcctggcccctggcagtcctgtcttgcaggtgttcgcatct
gatgccgatgctggtgtcaatggggctgtgacttacgagatcaaccggaggcagagcgag
ggtgatggacccttctccatcgacgcacacacggggctgctgcagttagagcggccactg
gactttgagcagcggcgggtccatgaactggtggtgcaagcacgagatggtggggctcac
cctgagctgggctcggcctttgtgactgtgcatgtgcgagatgccaatgacaatcagccc
tccatgactgtcatctttctcagtgcagatggctccccccaagtgtctgaggccgcccca
cctggacagctcgttgctcgcatctctgtgtcagacccagatgatggtgactttgcccat
gtcaatgtgtccctggaaggtggagagggccactttgccctaagcacccaagacagcgtc
atctatctggtgtgtgtggctcggcggctggatcgagaggagagggatgcctataacttg
agggttacagccacagactcaggctcacctccactgcgggctgaggctgcctttgtgctg
cacgtcactgatgtcaacgacaatgcacctgcctttgaccgccagctctaccgacctgag
cccctgcctgaggttgcgctgcctggcagctttgtagtgcgggtgactgctcgggatcct
gaccaaggcaccaatggtcaggtcacttatagcctagcccctggcgcccacacccactgg
ttctccattgaccccacctcaggcattatcactacggctgcctcactggactatgagttg
gaacctcagccacagctgattgtggtggccacagatggtggcctgccccctctagcctcc
tctgccacagttagcgtggccctgcaagatgtgaatgataatgagccccaattccagagg
actttctacaatgcctcactgcctgagggcacccagcctggaacttgcttcctgcaggtg
acagccacagacgcggatagtggcccatttggcctcctctcctattccttgggtgctgga
cttgggtcctccggatctcccccattccgcattgatgcccacagcggtgatgtgtgcaca
acccggaccctggaccgtgaccaggggccctcaagctttgacttcacagtgacagctgtg
gatgggggaggcctcaagtccatggtatatgtgaaggtgtttctgtcagacgagaatgac
aaccctcctcagttttatccacgggagtatgctgccagtataagtgcccagagtccacca
ggcacagctgtgctgaggttgcgtgcccatgaccctgaccagggatcccatgggcgactc
tcctaccatatcctggctggcaacagccccccactttttaccttggatgagcaatcaggg
ctgttgacagtagcctggcccttggccagacgggccaattctgtggtgcagctggagatc
ggggctgaggacggaggtggcctacaggcagaacccagtgcccgagtggacatcagcatt
gtgcctggaacccccacaccacccatatttgagcaactacagtatgttttttctgtgcca
gaggatgtggcaccaggcaccagtgtgggcatagtccaggcacacaacccaccaggtcgc
ttggcacctgtgaccctttccctatcaggtggggatccccgaggactcttctccctagat
gcggtatcaggactgttgcaaacacttcgccctctggaccgggagctactgggaccagtg
ttggagctggaggtgcgagcaggcagtggagtgcccccagctttcgctgtagctcgggtg
cgtgtgctgctggatgatgtgaatgacaactcccctgcctttcctgcacctgaagacacg
gtattgctaccaccaaacactgccccagggactcccatctatacactgcgggctcttgac
cccgactcaggtgttaacagtcgagtcacctttaccctgcttgctgggggtggtggagcc
ttcaccgtggaccccaccacaggccatgtacggcttatgaggcctctggggccctcagga
gggccagcccatgagctggagctggaggcccgggatgggggctccccaccacgcaccagc
cactttcgactacgggtggtggtacaggatgtgggaacccgtgggctggctccccgattc
aacagccctacctaccgtgtggacctgccctcaggcaccactgctggaactcaggtcctg
caagtgcaggcccaagcaccagatgggggccctatcacctatcaccttgcagcagaggga
gcaagtagcccctttggcctggagccacagagtgggtggctatgggtgcgggcagcacta
gaccgtgaggcccaggaattgtacatactgaaggtaatggcagtgtctgggtccaaagct
gagttggggcagcagacaggcacagccaccgtgagggtcagcatcctcaaccagaatgaa
cacagtccccgcttgtctgaggatcccaccttcctggctgtggctgagaaccagccccca
gggaccagcgtgggccgagtctttgccactgaccgagactcaggacccaatggacgtctg
acctacagcctgcaacagctgtctgaagacagcaaggccttccgcatccacccccagact
ggagaagtgaccacactccaaaccctggaccgtgagcagcagagcagctatcagctcctg
gtgcaggtgcaggatggagggagcccaccccgcagcaccacaggcactgtgcatgttgca
gtgcttgacctcaacgacaacagccccacgttcctgcaggcttcaggagctgctggtggg
ggcctccctatacaggtaccagaccgcgtgcctccgggaacactggtgacgactctgcag
gcgaaggatccagatgagggggagaatgggaccatcttgtacacgctaactggtcctggc
tcagagcttttctctctgcaccctcactcaggggagctgctcactgcagctcccctgatc
cgagcagagcggccccactatgtgctgacactgagtgctcatgaccaaggcagccctcct
cgaagtgccagcctccagctgctggtgcaggtgcttccctcagctcgcttggccgagccg
cccccagatctcgcagagcgggacccagcggcaccagtgcctgtcgtgctgacggtgaca
gcagctgagggactgcggcccggctctctgttgggctcggtggcagcgccagagcccgcg
ggtgtgggtgcactcacctacacactggtgggcggtgccgatcccgagggcaccttcgcg
ctggatgcggcctcagggcgcttgtacctggcgcggcccctggacttcgaagctggcccg
ccgtggcgcgcgcttacggtacgcgctgaggggccgggaggcgcgggcgcgcggctgctg
cgagtgcaggtgcaagtgcaggacgagaatgagcatgcgcccgcctttgcgcgcgacccg
ctggcgctggcgctgccagagaacccggagcccggcgcagcgctgtacactttccgcgcg
tcggacgccgacggccccggccccaatagcgacgtgcgctaccgcctgctgcgccaggag
ccgcccgtgccggcgcttcgcctggacgcgcgcaccggggcgctcagcgctccgcgcggc
ctggaccgagagaccactcccgcgctgctgctgctggtggaagccaccgaccggcccgcc
aacgccagccgccgtcgtgcagcgcgcgtttcagcgcgcgtcttcgtcacggatgagaat
gacaacgcgcctgtcttcgcctcgccgtcacgcgtgcgcctcccagaggaccagccgcct
gggcccgcggccctgcacgtggtagcccgggacccggatctgggcgaggctgcacgcgtg
tcctatcggctggcatctggcggggacggccacttccggctgcactcaagcactggagcg
ctgtccgtggtgcggccgttggaccgcgaacaacgagctgagcacgtactgacagtggtg
gcctcagaccacggctccccgccgcgctcggccacgcaggtcctgaccgtcagtgtcgct
gacgtcaacgacgaggcgcctactttccagcagcaggagtacagcgtcctcttgcgtgag
aacaaccctcctggcacatctctgctcaccctgcgagcaaccgaccccgacgtgggggcc
aacgggcaagtgacttatggaggcgtctctagcgaaagcttttctctggatcctgacact
ggtgttctcacgactcttcgggccctggatcgagaggaacaggaggagatcaacctgaca
gtgtatgcccaggacaggggctcacctcctcagttaacgcatgtcactgttcgagtggct
gtggaggatgagaatgaccatgcaccaacctttgggagtgcccatctctctctggaggtg
cctgagggccaggacccccagacccttaccatgcttcgggcctctgatccagatgtggga
gccaatgggcagttgcagtaccgcatcctagatggggacccatcaggagcctttgtccta
gaccttgcttctggagagtttggcaccatgcggccactagacagagaagtggagccagct
ttccagctgaggatagaggcccgggatggaggccagccagctctcagtgccacgctgctt
ttgacagtgacagtgctggatgccaatgaccatgctccagcctttcctgtgcctgcctac
tcggtggaggtgccggaggatgtgcctgcagggaccctgctgctgcagctacaggctcat
gaccctgatgctggagctaatggccatgtgacctactacctgggcgccggtacagcagga
gccttcctgctggagcccagctctggagaactgcgcacagctgcagccttggacagagaa
cagtgtcccagctacaccttttctgtgagtgcagtggatggtgcagctgctgggccccta
agcaccacagtgtctgtcaccatcacggtgcgcgatgtcaatgaccatgcacccaccttc
cccaccagtcctctgcgcctacgtctgccccgcccaggccccagcttcagtaccccaacc
ctggctctggccacactgagagctgaagatcgtgatgctggtgccaatgcttccattctg
taccggctggcaggcacaccacctcctggcactactgtggactcttacactggtgaaatc
cgcgtggcccgctctcctgtagctctaggcccccgagatcgtgtcctcttcattgtggcc
actgatcttggccgtccagctcgctctgccactggtgtgatcattgttggactgcagggg
gaagctgagcgtggaccccgctttccccgggctagcagtgaggctacgattcgtgagaat
gcgcccccagggactcctattgtctcccccagggccgtccatgcaggaggcacaaatgga
cccatcacctacagcattctcagtgggaatgagaaagggacattctccatccagcctagt
acaggtgccatcacagttcgctcagcagaggggctagacttcgaggtgagtccacggctg
cgactggtgctgcaggcagagagtggaggagcctttgccttcactgtgctgaccctgacc
ctgcaagatgccaacgacaatgctccccgtttcctgcggccccattatgtggccttcctt
cctgagtcccggcccttggaggggcccctgctgcaggtggaggcggatgacctggatcaa
ggctctggaggacagatttcctacagtctggctgcatcccagccggcacgtggattgttc
cacgtagacccaaccacaggcactatcactaccacagccatcctggaccgtgagatctgg
gctgaaacacggttggtgctgatggccacagacagagggagcccagccctggtgggctca
gctaccttgacggtgatggtcatcgacaccaatgacaatcgccccaccatcccccaaccc
tgggagctccgagtgtcagaagatgcgttattgggctcagagattgcacaggtaacaggg
aatgatgtggactcaggacccgtgctgtggtatgtgctaagcccatctgggccccaggat
cccttcagtgttggccgctatggaggccgtgtctccctcacggggcccctggactttgag
cagtgtgaccgctaccagctgcagctgctggcacatgatgggcctcatgagggccgtgcc
aacctcacagtgcttgtggaggatgtcaatgacaatgcacctgccttctcacagagcctc
taccaggtaatgctgcttgagcacacacccccaggcagtgccattctctccgtctctgcc
actgatcgggactcaggtgccaacggtcacatttcctaccacctggcttcccctgccgat
ggcttcagtgttgaccccaacaatgggaccctgttcacaatagtgggaacagtggccttg
ggccatgacgggtcaggagcagtggatgtggtgctggaagcacgagaccacggggctcca
ggccgggcagcacgagccacagtgcacgtgcagctgcaggaccagaacgaccacgccccg
agcttcacattgtcacactaccgtgtggctgtgactgaagacctgccccctggctccact
ctgctcaccctggaggctacagatgctgatggaagccgcagccatgccgctgtggactac
agcatcatcagtggcaactggggccgagtcttccagctggaacccaggctggctgaggct
ggggagagtgctggaccaggcccccgggcactgggctgcctggtgttgcttgaacctcta
gactttgaaagcctgacacagtacaatctaacagtggctgcagctgaccgtgggcagcca
ccccaaagctcagtcgtgccagtcactgtcactgtactagatgtcaatgacaacccacct
gtctttacccgagcatcctaccgtgtgacagtacctgaggacacacctgttggagctgag
ctgctgcatgtagaggcctctgacgctgaccctggccctcatggcctcgtgcgtttcact
gtcagctcaggcgacccatcagggctctttgagctggatgagagctcaggcaccttgcga
ctggcccatgccctggactgtgagacccaggctcgacatcagcttgtagtacaggctgct
gaccctgctggtgcacactttgctttggcaccagtgacaattgaggtccaggatgtgaat
gatcatggcccagccttcccactgaacttactcagcaccagcgtggccgagaatcagcct
ccaggcactctcgtgaccactctgcatgcaatcgacggggatgctggggcttttgggagg
ctccgttacagcctgttggaggctgggccaggacctgagggccgtgaggcatttgcactg
aacagctcaacaggggagttgcgtgcgcgagtgccctttgactatgagcacacagaaagc
ttccggctgctggtgggtgctgctgatgctgggaatctctcagcctctgtcactgtgtcg
gtgctagtgactggagaggatgagtatgaccctgtatttctggcaccagctttccacttc
caagtgcccgaaggtgcccggcgtggccacagcttgggtcacgtgcaggccacagatgag
gatgggggtgccgatggcctggttctgtattcccttgccacctcttccccctattttggt
attaaccagactacaggagccctgtacctgcgggtggacagtcgggcaccaggcagcgga
acagccacctctgggggtgggggccggacccggcgggaagcaccacgggagctgaggctg
gaggtgatagcacgggggcctctgcctggttcccggagtgccacagtgcctgtgaccgtg
gatatcacccacaccgcactgggcctggcacctgacctcaacctgctattagtaggggcc
gtggcagcctccttgggagttgtggtggtgcttgcactggcagccctggtcctaggactt
gttcgggcccgtagccgcaaggctgaggcagcccctggcccaatgtcacaggcagcaccc
ctagccagtgactcactgcagaaactgggccgggagccacctagtccaccaccctctgag
cacctctatcaccagactcttcccagctatggtgggccaggagctggaggaccctacccc
cgtggtggctccttggacccttcacattcaagtggccgaggatcagcagaggctgcagag
gatgatgagatccgcatgatcaatgagttcccccgtgtggccagtgtggcctcctctctg
gctgcccgtggccctgactcaggcatccagcaggatgcagatggtctgagtgacacatcc
tgcgaaccacctgcccctgacacctggtataagggccgaaaggcagggctgctgctgcca
ggtgcaggagccactctctacagagaggaggggcccccagccactgccacagccttcctg
gggggctgtggcctgagccctgcacccactggggactatggcttcccagcagatggcaag
ccatgtgtggcaggtgcgctgacagccattgtggccggcgaggaggagctccgtggcagc
tataactgggactacctgctgagctggtgccctcagttccaaccactggccagtgtcttc
acagagatcgctcggctcaaggatgaagctcggccatgtcccccagctccccgtatcgac
ccaccacccctcatcactgccgtggcccacccaggagccaagtctgtgccccccaagcca
gcaaacacagctgcagcccgggccatcttcccaccagcttctcaccgctcccccatcagc
catgaaggctccctgtcctcagctgccatgtcccccagcttctcaccctctctgtctcct
ctggctgctcgctcacccgttgtctcaccatttggggtggcccagggtccctcagcctca
gcactcagcgcagagtctggcctggagccacctgatgacacggagctgcacatctag

DBGET integrated database retrieval system