KEGG   Homo sapiens (human): 8647Help
Entry
8647              CDS       T01001                                 

Gene name
ABCB11, ABC16, BRIC2, BSEP, PFIC-2, PFIC2, PGY4, SPGP
Definition
(RefSeq) ATP binding cassette subfamily B member 11
  KO
K05664  ATP-binding cassette, subfamily B (MDR/TAP), member 11
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa02010  ABC transporters
hsa04976  Bile secretion
hsa04979  Cholesterol metabolism
Disease
H00624  Familial cholestasis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    8647 (ABCB11)
 Organismal Systems
  Digestive system
   04976 Bile secretion
    8647 (ABCB11)
   04979 Cholesterol metabolism
    8647 (ABCB11)
 Human Diseases
  Drug resistance
   01522 Endocrine resistance
    8647 (ABCB11)
Transporters [BR:hsa02000]
 ABC Transporters, Eukaryotic Type
  ABCB (MDR/TAP) subfamily
   ABCB11 subgroup
    8647 (ABCB11)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   8647 (ABCB11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ABC_membrane ABC_tran SMC_N RsgA_GTPase AAA_22 AAA_29 AAA_16 AAA_15 Zeta_toxin AAA_30 AAA_21 AAA_23
Motif
Other DBs
NCBI-GeneID: 8647
NCBI-ProteinID: NP_003733
OMIM: 603201
HGNC: 42
Ensembl: ENSG00000073734
Vega: OTTHUMG00000154039
Pharos: O95342(Tchem)
UniProt: O95342
Position
2q31.1
AA seq 1321 aa AA seqDB search
MSDSVILRSIKKFGEENDGFESDKSYNNDKKSRLQDEKKGDGVRVGFFQLFRFSSSTDIW
LMFVGSLCAFLHGIAQPGVLLIFGTMTDVFIDYDVELQELQIPGKACVNNTIVWTNSSLN
QNMTNGTRCGLLNIESEMIKFASYYAGIAVAVLITGYIQICFWVIAAARQIQKMRKFYFR
RIMRMEIGWFDCNSVGELNTRFSDDINKINDAIADQMALFIQRMTSTICGFLLGFFRGWK
LTLVIISVSPLIGIGAATIGLSVSKFTDYELKAYAKAGVVADEVISSMRTVAAFGGEKRE
VERYEKNLVFAQRWGIRKGIVMGFFTGFVWCLIFLCYALAFWYGSTLVLDEGEYTPGTLV
QIFLSVIVGALNLGNASPCLEAFATGRAAATSIFETIDRKPIIDCMSEDGYKLDRIKGEI
EFHNVTFHYPSRPEVKILNDLNMVIKPGEMTALVGPSGAGKSTALQLIQRFYDPCEGMVT
VDGHDIRSLNIQWLRDQIGIVEQEPVLFSTTIAENIRYGREDATMEDIVQAAKEANAYNF
IMDLPQQFDTLVGEGGGQMSGGQKQRVAIARALIRNPKILLLDMATSALDNESEAMVQEV
LSKIQHGHTIISVAHRLSTVRAADTIIGFEHGTAVERGTHEELLERKGVYFTLVTLQSQG
NQALNEEDIKDATEDDMLARTFSRGSYQDSLRASIRQRSKSQLSYLVHEPPLAVVDHKST
YEEDRKDKDIPVQEEVEPAPVRRILKFSAPEWPYMLVGSVGAAVNGTVTPLYAFLFSQIL
GTFSIPDKEEQRSQINGVCLLFVAMGCVSLFTQFLQGYAFAKSGELLTKRLRKFGFRAML
GQDIAWFDDLRNSPGALTTRLATDASQVQGAAGSQIGMIVNSFTNVTVAMIIAFSFSWKL
SLVILCFFPFLALSGATQTRMLTGFASRDKQALEMVGQITNEALSNIRTVAGIGKERRFI
EALETELEKPFKTAIQKANIYGFCFAFAQCIMFIANSASYRYGGYLISNEGLHFSYVFRV
ISAVVLSATALGRAFSYTPSYAKAKISAARFFQLLDRQPPISVYNTAGEKWDNFQGKIDF
VDCKFTYPSRPDSQVLNGLSVSISPGQTLAFVGSSGCGKSTSIQLLERFYDPDQGKVMID
GHDSKKVNVQFLRSNIGIVSQEPVLFACSIMDNIKYGDNTKEIPMERVIAAAKQAQLHDF
VMSLPEKYETNVGSQGSQLSRGEKQRIAIARAIVRDPKILLLDEATSALDTESEKTVQVA
LDKAREGRTCIVIAHRLSTIQNADIIAVMAQGVVIEKGTHEELMAQKGAYYKLVTTGSPI
S
NT seq 3966 nt NT seq  +upstreamnt  +downstreamnt
atgtctgactcagtaattcttcgaagtataaagaaatttggagaggagaatgatggtttt
gagtcagataaatcatataataatgataagaaatcaaggttacaagatgagaagaaaggt
gatggcgttagagttggcttctttcaattgtttcggttttcttcatcaactgacatttgg
ctgatgtttgtgggaagtttgtgtgcatttctccatggaatagcccagccaggcgtgcta
ctcatttttggcacaatgacagatgtttttattgactacgacgttgagttacaagaactc
cagattccaggaaaagcatgtgtgaataacaccattgtatggactaacagttccctcaac
cagaacatgacaaatggaacacgttgtgggttgctgaacatcgagagcgaaatgatcaaa
tttgccagttactatgctggaattgctgtcgcagtacttatcacaggatatattcaaata
tgcttttgggtcattgccgcagctcgtcagatacagaaaatgagaaaattttactttagg
agaataatgagaatggaaatagggtggtttgactgcaattcagtgggggagctgaataca
agattctctgatgatattaataaaatcaatgatgccatagctgaccaaatggcccttttc
attcagcgcatgacctcgaccatctgtggtttcctgttgggatttttcaggggttggaaa
ctgaccttggttattatttctgtcagccctctcattgggattggagcagccaccattggt
ctgagtgtgtccaagtttacggactatgagctgaaggcctatgccaaagcaggggtggtg
gctgatgaagtcatttcatcaatgagaacagtggctgcttttggtggtgagaaaagagag
gttgaaaggtatgagaaaaatcttgtgttcgcccagcgttggggaattagaaaaggaata
gtgatgggattctttactggattcgtgtggtgtctcatctttttgtgttatgcactggcc
ttctggtacggctccacacttgtcctggatgaaggagaatatacaccaggaacccttgtc
cagattttcctcagtgtcatagtaggagctttaaatcttggcaatgcctctccttgtttg
gaagcctttgcaactggacgtgcagcagccaccagcatttttgagacaatagacaggaaa
cccatcattgactgcatgtcagaagatggttacaagttggatcgaatcaagggtgaaatt
gaattccataatgtgaccttccattatccttccagaccagaggtgaagattctaaatgac
ctcaacatggtcattaaaccaggggaaatgacagctctggtaggacccagtggagctgga
aaaagtacagcactgcaactcattcagcgattctatgacccctgtgaaggaatggtgacc
gtggatggccatgacattcgctctcttaacattcagtggcttagagatcagattgggata
gtggagcaagagccagttctgttctctaccaccattgcagaaaatattcgctatggcaga
gaagatgcaacaatggaagacatagtccaagctgccaaggaggccaatgcctacaacttc
atcatggacctgccacagcaatttgacacccttgttggagaaggaggaggccagatgagt
ggtggccagaaacaaagggtagctatcgccagagccctcatccgaaatcccaagattctg
cttttggacatggccacctcagctctggacaatgagagtgaagccatggtgcaagaagtg
ctgagtaagattcagcatgggcacacaatcatttcagttgctcatcgcttgtctacggtc
agagctgcagataccatcattggttttgaacatggcactgcagtggaaagagggacccat
gaagaattactggaaaggaaaggtgtttacttcactctagtgactttgcaaagccaggga
aatcaagctcttaatgaagaggacataaaggatgcaactgaagatgacatgcttgcgagg
acctttagcagagggagctaccaggatagtttaagggcttccatccggcaacgctccaag
tctcagctttcttacctggtgcacgaacctccattagctgttgtagatcataagtctacc
tatgaagaagatagaaaggacaaggacattcctgtgcaggaagaagttgaacctgcccca
gttaggaggattctgaaattcagtgctccagaatggccctacatgctggtagggtctgtg
ggtgcagctgtgaacgggacagtcacacccttgtatgcctttttattcagccagattctt
gggactttttcaattcctgataaagaggaacaaaggtcacagatcaatggtgtgtgccta
ctttttgtagcaatgggctgtgtatctcttttcacccaatttctacagggatatgccttt
gctaaatctggggagctcctaacaaaaaggctacgtaaatttggtttcagggcaatgctg
gggcaagatattgcctggtttgatgacctcagaaatagccctggagcattgacaacaaga
cttgctacagatgcttcccaagttcaaggggctgccggctctcagatcgggatgatagtc
aattccttcactaacgtcactgtggccatgatcattgccttctcctttagctggaagctg
agcctggtcatcttgtgcttcttccccttcttggctttatcaggagccacacagaccagg
atgttgacaggatttgcctctcgagataagcaggccctggagatggtgggacagattaca
aatgaagccctcagtaacatccgcactgttgctggaattggaaaggagaggcggttcatt
gaagcacttgagactgagctggagaagcccttcaagacagccattcagaaagccaatatt
tacggattctgctttgcctttgcccagtgcatcatgtttattgcgaattctgcttcctac
agatatggaggttacttaatctccaatgaggggctccatttcagctatgtgttcagggtg
atctctgcagttgtactgagtgcaacagctcttggaagagccttctcttacaccccaagt
tatgcaaaagctaaaatatcagctgcacgcttttttcaactgctggaccgacaaccccca
atcagtgtatacaatactgcaggtgaaaaatgggacaacttccaggggaagattgatttt
gttgattgtaaatttacatatccttctcgacctgactcgcaagttctgaatggtctctca
gtgtcgattagtccagggcagacactggcgtttgttgggagcagtggatgtggcaaaagc
actagcattcagctgttggaacgtttctatgatcctgatcaagggaaggtgatgatagat
ggtcatgacagcaaaaaagtaaatgtccagttcctccgctcaaacattggaattgtttcc
caggaaccagtgttgtttgcctgtagcataatggacaatatcaagtatggagacaacacc
aaagaaattcccatggaaagagtcatagcagctgcaaaacaggctcagctgcatgatttt
gtcatgtcactcccagagaaatatgaaactaacgttgggtcccaggggtctcaactctct
agaggggagaaacaacgcattgctattgctcgggccattgtacgagatcctaaaatcttg
ctactagatgaagccacttctgccttagacacagaaagtgaaaagacggtgcaggttgct
ctagacaaagccagagagggtcggacctgcattgtcattgcccatcgcttgtccaccatc
cagaacgcggatatcattgctgtcatggcacagggggtggtgattgaaaaggggacccat
gaagaactgatggcccaaaaaggagcctactacaaactagtcaccactggatcccccatc
agttga

DBGET integrated database retrieval system