KEGG   Homo sapiens (human): 8648Help
Entry
8648              CDS       T01001                                 

Gene name
NCOA1, F-SRC-1, KAT13A, RIP160, SRC1, bHLHe42, bHLHe74
Definition
(RefSeq) nuclear receptor coactivator 1
  KO
K09101  nuclear receptor coactivator 1 [EC:2.3.1.48]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04915  Estrogen signaling pathway
hsa04919  Thyroid hormone signaling pathway
hsa05200  Pathways in cancer
hsa05224  Breast cancer
Network
N00286  Nuclear-initiated estrogen signaling pathway
N00287  ESR1-positive to nuclear-initiated estrogen signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   04915 Estrogen signaling pathway
    8648 (NCOA1)
   04919 Thyroid hormone signaling pathway
    8648 (NCOA1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    8648 (NCOA1)
   05224 Breast cancer
    8648 (NCOA1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     8648 (NCOA1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    8648 (NCOA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAS_11 NCOA_u2 DUF1518 SRC-1 Nuc_rec_co-act PAS PAS_3 DUF4927 PAS_9 HLH PAS_4
Motif
Other DBs
NCBI-GeneID: 8648
NCBI-ProteinID: NP_003734
OMIM: 602691
HGNC: 7668
Ensembl: ENSG00000084676
Vega: OTTHUMG00000125523
Pharos: Q15788(Tchem)
UniProt: Q15788
Structure
PDB: 

Position
2p23.3
AA seq 1441 aa AA seqDB search
MSGLGDSSSDPANPDSHKRKGSPCDTLASSTEKRRREQENKYLEELAELLSANISDIDSL
SVKPDKCKILKKTVDQIQLMKRMEQEKSTTDDDVQKSDISSSSQGVIEKESLGPLLLEAL
DGFFFVVNCEGRIVFVSENVTSYLGYNQEELMNTSVYSILHVGDHAEFVKNLLPKSLVNG
VPWPQEATRRNSHTFNCRMLIHPPDEPGTENQEACQRYEVMQCFTVSQPKSIQEDGEDFQ
SCLICIARRLPRPPAITGVESFMTKQDTTGKIISIDTSSLRAAGRTGWEDLVRKCIYAFF
QPQGREPSYARQLFQEVMTRGTASSPSYRFILNDGTMLSAHTKCKLCYPQSPDMQPFIMG
IHIIDREHSGLSPQDDTNSGMSIPRVNPSVNPSISPAHGVARSSTLPPSNSNMVSTRINR
QQSSDLHSSSHSNSSNSQGSFGCSPGSQIVANVALNQGQASSQSSNPSLNLNNSPMEGTG
ISLAQFMSPRRQVTSGLATRPRMPNNSFPPNISTLSSPVGMTSSACNNNNRSYSNIPVTS
LQGMNEGPNNSVGFSASSPVLRQMSSQNSPSRLNIQPAKAESKDNKEIASILNEMIQSDN
SSSDGKPLDSGLLHNNDRLSDGDSKYSQTSHKLVQLLTTTAEQQLRHADIDTSCKDVLSC
TGTSNSASANSSGGSCPSSHSSLTERHKILHRLLQEGSPSDITTLSVEPDKKDSASTSVS
VTGQVQGNSSIKLELDASKKKESKDHQLLRYLLDKDEKDLRSTPNLSLDDVKVKVEKKEQ
MDPCNTNPTPMTKPTPEEIKLEAQSQFTADLDQFDQLLPTLEKAAQLPGLCETDRMDGAV
TSVTIKSEILPASLQSATARPTSRLNRLPELELEAIDNQFGQPGTGDQIPWTNNTVTAIN
QSKSEDQCISSQLDELLCPPTTVEGRNDEKALLEQLVSFLSGKDETELAELDRALGIDKL
VQGGGLDVLSERFPPQQATPPLIMEERPNLYSQPYSSPSPTANLPSPFQGMVRQKPSLGT
MPVQVTPPRGAFSPGMGMQPRQTLNRPPAAPNQLRLQLQQRLQGQQQLIHQNRQAILNQF
AATAPVGINMRSGMQQQITPQPPLNAQMLAQRQRELYSQQHRQRQLIQQQRAMLMRQQSF
GNNLPPSSGLPVQMGNPRLPQGAPQQFPYPPNYGTNPGTPPASTSPFSQLAANPEASLAN
RNSMVSRGMTGNIGGQFGTGINPQMQQNVFQYPGAGMVPQGEANFAPSLSPGSSMVPMPI
PPPQSSLLQQTPPASGYQSPDMKAWQQGAIGNNNVFSQAVQNQPTPAQPGVYNNMSITVS
MAGGNTNVQNMNPMMAQMQMSSLQMPGMNTVCPEQINDPALRHTGLYCNQLSSTDLLKTE
ADGTQQVQQVQVFADVQCTVNLVGGDPYLNQPGPLGTQKPTSGPQTPQAQQKSLLQQLLT
E
NT seq 4326 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcctcggggacagttcatccgaccctgctaacccagactcacataagaggaaa
ggatcgccatgtgacacactggcatcaagcacggaaaagaggcgcagggagcaagaaaat
aaatatttagaagaactagctgagttactgtctgccaacattagtgacattgacagcttg
agtgtaaaaccagacaaatgcaagattttgaagaaaacagtcgatcagatacagctaatg
aagagaatggaacaagagaaatcaacaactgatgacgatgtacagaaatcagacatctca
tcaagtagtcaaggagtgatagaaaaggaatccttgggacctcttcttttggaggctttg
gatggatttttctttgttgtgaactgtgaagggagaattgtatttgtgtcagagaatgta
accagctacttaggttacaatcaggaggaattaatgaatacgagcgtctacagcatactg
cacgtgggggatcatgcagaatttgtgaagaatctgctaccaaaatcactagtaaatgga
gttccttggcctcaagaggcaacacgacgaaatagccatacctttaactgcaggatgcta
attcaccctccagatgagccagggaccgagaaccaagaagcttgccagcgttatgaagta
atgcagtgtttcactgtgtcacagccaaaatcaattcaagaggatggagaagatttccag
tcatgtctgatttgtattgcacggcgattacctcggcctccagctattacgggtgtagaa
tcctttatgaccaagcaagatactacaggtaaaatcatctctattgatactagttccctg
agagctgctggcagaactggttgggaagatttagtgaggaagtgcatttatgcttttttc
caacctcagggcagagaaccatcttatgccagacagctgttccaagaagtgatgactcgt
ggcactgcctccagcccctcctatagattcatattgaatgatgggacaatgcttagcgcc
cacaccaagtgtaaactttgctaccctcaaagtccagacatgcaacctttcatcatggga
attcatatcatcgacagggagcacagtgggctttctcctcaagatgacactaattctgga
atgtcaattccccgagtaaatccctcggtcaatcctagtatctctccagctcatggtgtg
gctcgttcatccacattgccaccatccaacagcaacatggtatccaccagaataaaccgc
cagcagagctcagaccttcatagcagcagtcatagtaattctagcaacagccaaggaagt
ttcggatgctcacccggaagtcagattgtagccaatgttgccttaaaccaaggacaggcc
agttcacagagcagtaatccctctttaaacctcaataattctcctatggaaggtacagga
atatccctagcacagttcatgtctccaaggagacaggttacttctggattggcaacaagg
cccaggatgccaaacaattcctttcctcctaatatttcgacattaagctctcccgttggc
atgacaagtagtgcctgtaataataataaccgatcttattcaaacatcccagtaacatct
ttacagggtatgaatgaaggacccaataactccgttggcttctctgccagttctccagtc
ctcaggcagatgagctcacagaattcacctagcagattaaatatacaaccagcaaaagct
gagtccaaagataacaaagagattgcctcaattttaaatgaaatgattcaatctgacaac
agctctagtgatggcaaacctctggattcagggcttctgcataacaatgacagactttca
gatggagacagtaaatactctcaaaccagtcacaaactagtgcagcttttgacaacaact
gccgaacagcagttacggcatgctgatatagacacaagctgcaaagatgtcctgtcttgc
acaggcacttccaactctgcctctgctaactcttcaggaggttcttgtccctcttctcat
agctcattgacagaacggcataaaattctacaccggctcttacaggagggtagcccctca
gatatcaccactttgtctgtcgagcctgataaaaaggacagtgcatctacttctgtgtca
gtgactggacaggtacaaggaaactccagtataaaactagaactggatgcttcaaagaaa
aaagaatcaaaagaccatcagctcctacgctatcttttagataaagatgagaaagattta
agatcaactccaaacctgagcctggatgatgtaaaggtgaaagtggaaaagaaagaacag
atggatccatgtaatacaaacccaaccccaatgaccaaacccactcctgaggaaataaaa
ctggaggcccagagccagtttacagctgaccttgaccagtttgatcagttactgcccacg
ctggagaaggcagcacagttgccaggcttatgtgagacagacaggatggatggtgcggtc
accagtgtaaccatcaaatcggagatcctgccagcttcacttcagtccgccactgccaga
cccacttccaggctaaatagattacctgagctggaattggaagcaattgataaccaattt
ggacaaccaggaacaggcgatcagattccatggacaaataatacagtgacagctataaat
cagagtaaatcagaagaccagtgtattagctcacaattagatgagcttctctgtccaccc
acaacagtagaagggagaaatgatgagaaggctcttcttgaacagctggtatccttcctt
agtggcaaagatgaaactgagctagctgaactagacagagctctgggaattgacaaactt
gttcaggggggtggattagatgtattatcagagagatttccaccacaacaagcaacgcca
cctttgatcatggaagaaagacccaacctttattcccagccttactcttctccttctcct
actgccaatctccctagccctttccaaggcatggtcaggcaaaaaccttcactggggacg
atgcctgttcaagtaacacctccccgaggtgctttttcacctggcatgggcatgcagccc
aggcaaactctaaacagacctccggctgcacctaaccagcttcgacttcaactacagcag
cgattacagggacaacagcagttgatacaccaaaatcggcaagctatcttaaaccagttt
gcagcaactgctcctgttggcatcaatatgagatcaggcatgcaacagcaaattacacct
cagccacccctgaatgctcaaatgttggcacaacgtcagcgggaactgtacagtcaacag
caccgacagaggcagctaatacagcagcaaagagccatgcttatgaggcagcaaagcttt
gggaacaacctccctccctcatctggactaccagttcaaatggggaacccccgtcttcct
cagggtgctccacagcaattcccctatccaccaaactatggtacaaatccaggaacccca
cctgcttctaccagcccgttttcacaactagcagcaaatcctgaagcatccttggccaac
cgcaacagcatggtgagcagaggcatgacaggaaacataggaggacagtttggcactgga
atcaatcctcagatgcagcagaatgtcttccagtatccaggagcaggaatggttccccaa
ggtgaggccaactttgctccatctctaagccctgggagctccatggtgccgatgccaatc
cctcctcctcagagttctcttctccagcaaactccacctgcctccgggtatcagtcacca
gacatgaaggcctggcagcaaggagcgataggaaacaacaatgtgttcagtcaagctgtc
cagaaccagcccacgcctgcacagccaggagtatacaacaacatgagcatcaccgtttcc
atggcaggtggaaatacgaatgttcagaacatgaacccaatgatggcccagatgcagatg
agctctttgcagatgccaggaatgaacactgtgtgccctgagcagataaatgatcccgca
ctgagacacacaggcctctactgcaaccagctctcatccactgaccttctcaaaacagaa
gcagatggaacccagcaggtgcaacaggttcaggtgtttgctgacgtccagtgtacagtg
aatctggtaggcggggacccttacctgaaccagcctggtccactgggaactcaaaagccc
acgtcaggaccacagaccccccaggcccagcagaagagcctccttcagcagctactgact
gaataa

DBGET integrated database retrieval system