KEGG   Homo sapiens (human): 8649Help
Entry
8649              CDS       T01001                                 

Gene name
LAMTOR3, MAP2K1IP1, MAPBP, MAPKSP1, MP1, PRO0633, Ragulator3
Definition
(RefSeq) late endosomal/lysosomal adaptor, MAPK and MTOR activator 3
  KO
K04370  ragulator complex protein LAMTOR3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    8649 (LAMTOR3)
   04150 mTOR signaling pathway
    8649 (LAMTOR3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPKK1_Int
Motif
Other DBs
NCBI-GeneID: 8649
NCBI-ProteinID: NP_068805
OMIM: 603296
HGNC: 15606
Ensembl: ENSG00000109270
Vega: OTTHUMG00000131050
Pharos: Q9UHA4(Tbio)
UniProt: Q9UHA4
Structure
PDB: 

Position
4q23
AA seq 124 aa AA seqDB search
MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQG
SKLGLSKNKSIICYYNTYQVVQFNRLPLVVSFIASSSANTGLIVSLEKELAPLFEELRQV
VEVS
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atggcggatgacctaaagcgattcttgtataaaaagttaccaagtgttgaagggctccat
gccattgttgtgtcagatagagatggagtacctgttattaaagtggcaaatgacaatgct
ccagagcatgctttgcgacctggtttcttatccacttttgcccttgcaacagaccaagga
agcaaacttggactttccaaaaataaaagtatcatctgttactataacacctaccaggtg
gttcaatttaatcgtttacctttggtggtgagtttcatagccagcagcagtgccaataca
ggactaattgtcagcctagaaaaggaacttgctccattgtttgaagaactgagacaagtt
gtggaagtttcttaa

DBGET integrated database retrieval system