KEGG   Homo sapiens (human): 8650
Entry
8650              CDS       T01001                                 
Symbol
NUMB, C14orf41, S171, c14_5527
Name
(RefSeq) NUMB endocytic adaptor protein
  KO
K06057  numb
Organism
hsa  Homo sapiens (human)
Pathway
hsa04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    8650 (NUMB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    8650 (NUMB)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    8650 (NUMB)
SSDB
Motif
Pfam: PID NumbF PTB PID_2
Other DBs
NCBI-GeneID: 8650
NCBI-ProteinID: NP_001005743
OMIM: 603728
HGNC: 8060
Ensembl: ENSG00000133961
UniProt: P49757
Position
14:complement(73275216..73458546)
AA seq 651 aa
MNKLRQSFRRKKDVYVPEASRPHQWQTDEEGVRTGKCSFPVKYLGHVEVDESRGMHICED
AVKRLKAERKFFKGFFGKTGKKAVKAVLWVSADGLRVVDEKTKDLIVDQTIEKVSFCAPD
RNFDRAFSYICRDGTTRRWICHCFMAVKDTGERLSHAVGCAFAACLERKQKREKECGVTA
TFDASRTTFTREGSFRVTTATEQAEREEIMKQMQDAKKAETDKIVVGSSVAPGNTAPSPS
SPTSPTSDATTSLEMNNPHAIPRRHAPIEQLARQGSFRGFPALSQKMSPFKRQLSLRINE
LPSTMQRKTDFPIKNAVPEVEGEAESISSLCSQITNAFSTPEDPFSSAPMTKPVTVVAPQ
SPTFQANGTDSAFHVLAKPAHTALAPVAMPVRETNPWAHAPDAANKEIAATCSGTEWGQS
SGAASPGLFQAGHRRTPSEADRWLEEVSKSVRAQQPQASAAPLQPVLQPPPPTAISQPAS
PFQGNAFLTSQPVPVGVVPALQPAFVPAQSYPVANGMPYPAPNVPVVGITPSQMVANVFG
TAGHPQAAHPHQSPSLVRQQTFPHYEASSATTSPFFKPPAQHLNGSAAFNGVDDGRLASA
DRHTEVPTGTCPVDPFEAQWAALENKSKQRTNPSPTNPFSSDLQKTFEIEL
NT seq 1956 nt   +upstreamnt  +downstreamnt
atgaacaaattacggcaaagttttaggagaaagaaggatgtttatgttccagaggccagt
cgtccacatcagtggcagacagatgaagaaggcgttcgcaccggaaaatgtagcttcccg
gttaagtaccttggccatgtagaagttgatgaatcaagaggaatgcacatctgtgaagat
gctgtaaaaagattgaaagctgaaaggaagttcttcaaaggcttctttggaaaaactgga
aagaaagcagttaaagcagttctgtgggtctcagcagatggactcagagttgtggatgaa
aaaactaaggacctcatagttgaccagacgatagagaaagtttctttctgtgccccagac
aggaactttgatagagccttttcttacatatgccgtgatggcaccactcgtcgctggatc
tgtcactgcttcatggctgtcaaggacacaggtgaaaggttgagccatgcagtaggctgt
gcttttgcagcctgtttagagcgcaagcagaagcgggagaaggaatgtggagtgactgct
acttttgatgctagtcggaccacttttacaagagaaggatcattccgtgtcacaacagcc
actgaacaagcagaaagagaggagatcatgaaacaaatgcaagatgccaagaaagctgaa
acagataagatagtcgttggttcatcagttgcccctggcaacactgccccatccccatcc
tctcccacctctcctacttctgatgccacgacctctctggagatgaacaatcctcatgcc
atcccacgccggcatgctccaattgaacagcttgctcgccaaggctctttccgaggtttt
cctgctcttagccagaagatgtcaccctttaaacgccaactatccctacgcatcaatgag
ttgccttccactatgcagaggaagactgatttccccattaaaaatgcagtgccagaagta
gaaggggaggcagagagcatcagctccctgtgctcacagatcaccaatgccttcagcaca
cctgaggaccccttctcatctgctccgatgaccaaaccagtgacagtggtggcaccacaa
tctcctaccttccaagctaatggcactgactcagccttccatgtgcttgctaagccagcc
catactgctctagcacccgtagcaatgcctgtgcgtgaaaccaacccttgggcccatgcc
cctgatgctgctaacaaggaaattgcagccacatgttcggggaccgagtggggtcaatct
tctggtgctgcctctccaggtctcttccaggccggtcatagacgtactccctctgaggcc
gaccgatggttagaagaggtgtctaagagcgtccgggctcagcagccccaggcctcagct
gctcctctgcagccagttctccagcctcctccacccactgccatctcccagccagcatca
cctttccaagggaatgcattcctcacctctcagcctgtgccagtgggtgtggtcccagcc
ctgcaaccagcctttgtccctgcccagtcctatcctgtggccaatggaatgccctatcca
gcccctaatgtgcctgtggtgggcatcactccctcccagatggtggccaacgtatttggc
actgcaggccaccctcaggctgcccatccccatcagtcacccagcctggtcaggcagcag
acattccctcactacgaggcaagcagtgctaccaccagtcccttctttaagcctcctgct
cagcacctcaacggttctgcagctttcaatggtgtagatgatggcaggttggcctcagca
gacaggcatacagaggttcctacaggcacctgcccagtggatccttttgaagcccagtgg
gctgcattagaaaataagtccaagcagcgtactaatccctcccctaccaaccctttctcc
agtgacttacagaagacgtttgaaattgaactttaa

DBGET integrated database retrieval system