KEGG   Homo sapiens (human): 8650Help
Entry
8650              CDS       T01001                                 

Gene name
NUMB, C14orf41, S171, c14_5527
Definition
(RefSeq) NUMB, endocytic adaptor protein
  KO
K06057  numb
Organism
hsa  Homo sapiens (human)
Pathway
hsa04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    8650 (NUMB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    8650 (NUMB)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   LDLR adaptor proteins
    8650 (NUMB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PID NumbF PTB PID_2
Motif
Other DBs
NCBI-GeneID: 8650
NCBI-ProteinID: NP_001005743
OMIM: 603728
HGNC: 8060
Ensembl: ENSG00000133961
Vega: OTTHUMG00000171436
Pharos: P49757(Tbio)
UniProt: P49757 A0A024R6F4
Structure
PDB: 

Position
14q24.2-q24.3
AA seq 651 aa AA seqDB search
MNKLRQSFRRKKDVYVPEASRPHQWQTDEEGVRTGKCSFPVKYLGHVEVDESRGMHICED
AVKRLKAERKFFKGFFGKTGKKAVKAVLWVSADGLRVVDEKTKDLIVDQTIEKVSFCAPD
RNFDRAFSYICRDGTTRRWICHCFMAVKDTGERLSHAVGCAFAACLERKQKREKECGVTA
TFDASRTTFTREGSFRVTTATEQAEREEIMKQMQDAKKAETDKIVVGSSVAPGNTAPSPS
SPTSPTSDATTSLEMNNPHAIPRRHAPIEQLARQGSFRGFPALSQKMSPFKRQLSLRINE
LPSTMQRKTDFPIKNAVPEVEGEAESISSLCSQITNAFSTPEDPFSSAPMTKPVTVVAPQ
SPTFQANGTDSAFHVLAKPAHTALAPVAMPVRETNPWAHAPDAANKEIAATCSGTEWGQS
SGAASPGLFQAGHRRTPSEADRWLEEVSKSVRAQQPQASAAPLQPVLQPPPPTAISQPAS
PFQGNAFLTSQPVPVGVVPALQPAFVPAQSYPVANGMPYPAPNVPVVGITPSQMVANVFG
TAGHPQAAHPHQSPSLVRQQTFPHYEASSATTSPFFKPPAQHLNGSAAFNGVDDGRLASA
DRHTEVPTGTCPVDPFEAQWAALENKSKQRTNPSPTNPFSSDLQKTFEIEL
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaattacggcaaagttttaggagaaagaaggatgtttatgttccagaggccagt
cgtccacatcagtggcagacagatgaagaaggcgttcgcaccggaaaatgtagcttcccg
gttaagtaccttggccatgtagaagttgatgaatcaagaggaatgcacatctgtgaagat
gctgtaaaaagattgaaagctgaaaggaagttcttcaaaggcttctttggaaaaactgga
aagaaagcagttaaagcagttctgtgggtctcagcagatggactcagagttgtggatgaa
aaaactaaggacctcatagttgaccagacgatagagaaagtttctttctgtgccccagac
aggaactttgatagagccttttcttacatatgccgtgatggcaccactcgtcgctggatc
tgtcactgcttcatggctgtcaaggacacaggtgaaaggttgagccatgcagtaggctgt
gcttttgcagcctgtttagagcgcaagcagaagcgggagaaggaatgtggagtgactgct
acttttgatgctagtcggaccacttttacaagagaaggatcattccgtgtcacaacagcc
actgaacaagcagaaagagaggagatcatgaaacaaatgcaagatgccaagaaagctgaa
acagataagatagtcgttggttcatcagttgcccctggcaacactgccccatccccatcc
tctcccacctctcctacttctgatgccacgacctctctggagatgaacaatcctcatgcc
atcccacgccggcatgctccaattgaacagcttgctcgccaaggctctttccgaggtttt
cctgctcttagccagaagatgtcaccctttaaacgccaactatccctacgcatcaatgag
ttgccttccactatgcagaggaagactgatttccccattaaaaatgcagtgccagaagta
gaaggggaggcagagagcatcagctccctgtgctcacagatcaccaatgccttcagcaca
cctgaggaccccttctcatctgctccgatgaccaaaccagtgacagtggtggcaccacaa
tctcctaccttccaagctaatggcactgactcagccttccatgtgcttgctaagccagcc
catactgctctagcacccgtagcaatgcctgtgcgtgaaaccaacccttgggcccatgcc
cctgatgctgctaacaaggaaattgcagccacatgttcggggaccgagtggggtcaatct
tctggtgctgcctctccaggtctcttccaggccggtcatagacgtactccctctgaggcc
gaccgatggttagaagaggtgtctaagagcgtccgggctcagcagccccaggcctcagct
gctcctctgcagccagttctccagcctcctccacccactgccatctcccagccagcatca
cctttccaagggaatgcattcctcacctctcagcctgtgccagtgggtgtggtcccagcc
ctgcaaccagcctttgtccctgcccagtcctatcctgtggccaatggaatgccctatcca
gcccctaatgtgcctgtggtgggcatcactccctcccagatggtggccaacgtatttggc
actgcaggccaccctcaggctgcccatccccatcagtcacccagcctggtcaggcagcag
acattccctcactacgaggcaagcagtgctaccaccagtcccttctttaagcctcctgct
cagcacctcaacggttctgcagctttcaatggtgtagatgatggcaggttggcctcagca
gacaggcatacagaggttcctacaggcacctgcccagtggatccttttgaagcccagtgg
gctgcattagaaaataagtccaagcagcgtactaatccctcccctaccaaccctttctcc
agtgacttacagaagacgtttgaaattgaactttaa

DBGET integrated database retrieval system