KEGG   Homo sapiens (human): 8658Help
Entry
8658              CDS       T01001                                 

Gene name
TNKS, ARTD5, PARP-5a, PARP5A, PARPL, TIN1, TINF1, TNKS1, pART5
Definition
(RefSeq) tankyrase
  KO
K10799  tankyrase [EC:2.4.2.30]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    8658 (TNKS)
   03036 Chromosome and associated proteins [BR:hsa03036]
    8658 (TNKS)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     8658 (TNKS)
DNA replication proteins [BR:hsa03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     8658 (TNKS)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Pericentriolar materials (PCM)
    Other PCM proteins
     8658 (TNKS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank_5 Ank Ank_4 Ank_3 PARP SAM_2 SAM_1
Motif
Other DBs
NCBI-GeneID: 8658
NCBI-ProteinID: NP_003738
OMIM: 603303
HGNC: 11941
Ensembl: ENSG00000173273
Vega: OTTHUMG00000090481
Pharos: O95271(Tchem)
UniProt: O95271
Structure
PDB: 

Position
8p23.1
AA seq 1327 aa AA seqDB search
MAASRRSQHHHHHHQQQLQPAPGASAPPPPPPPPLSPGLAPGTTPASPTASGLAPFASPR
HGLALPEGDGSRDPPDRPRSPDPVDGTSCCSTTSTICTVAAAPVVPAVSTSSAAGVAPNP
AGSGSNNSPSSSSSPTSSSSSSPSSPGSSLAESPEAAGVSSTAPLGPGAAGPGTGVPAVS
GALRELLEACRNGDVSRVKRLVDAANVNAKDMAGRKSSPLHFAAGFGRKDVVEHLLQMGA
NVHARDDGGLIPLHNACSFGHAEVVSLLLCQGADPNARDNWNYTPLHEAAIKGKIDVCIV
LLQHGADPNIRNTDGKSALDLADPSAKAVLTGEYKKDELLEAARSGNEEKLMALLTPLNV
NCHASDGRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHYEVTEL
LLKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSHGADPTLVNCHGKSAVDMAPTPEL
RERLTYEFKGHSLLQAAREADLAKVKKTLALEIINFKQPQSHETALHCAVASLHPKRKQV
TELLLRKGANVNEKNKDFMTPLHVAAERAHNDVMEVLHKHGAKMNALDTLGQTALHRAAL
AGHLQTCRLLLSYGSDPSIISLQGFTAAQMGNEAVQQILSESTPIRTSDVDYRLLEASKA
GDLETVKQLCSSQNVNCRDLEGRHSTPLHFAAGYNRVSVVEYLLHHGADVHAKDKGGLVP
LHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKYEICKLLLKHGADPTKKN
RDGNTPLDLVKEGDTDIQDLLRGDAALLDAAKKGCLARVQKLCTPENINCRDTQGRNSTP
LHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLIKYNTCVNATD
KWAFTPLHEAAQKGRTQLCALLLAHGADPTMKNQEGQTPLDLATADDIRALLIDAMPPEA
LPTCFKPQATVVSASLISPASTPSCLSAASSIDNLTGPLAELAVGGASNAGDGAAGTERK
EGEVAGLDMNISQFLKSLGLEHLRDIFETEQITLDVLADMGHEELKEIGINAYGHRHKLI
KGVERLLGGQQGTNPYLTFHCVNQGTILLDLAPEDKEYQSVEEEMQSTIREHRDGGNAGG
IFNRYNVIRIQKVVNKKLRERFCHRQKEVSEENHNHHNERMLFHGSPFINAIIHKGFDER
HAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPTHKDRSCYICHRQMLFCRVTLGKSF
LQFSTMKMAHAPPGHHSVIGRPSVNGLAYAEYVIYRGEQAYPEYLITYQIMKPEAPSQTA
TAAEQKT
NT seq 3984 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgtcgcgtcgctctcagcatcatcaccaccatcatcaacaacagctccagccc
gccccaggggcttcagcgccgccgccgccacctcctcccccactcagccctggcctggcc
ccggggaccaccccagcctctcccacggccagcggcctggcccccttcgcctccccgcgg
cacggcctagcgctgccggagggggatggcagtcgggatccgcccgacaggccccgatcc
ccggacccggttgacggtaccagctgttgcagtaccaccagcacaatctgtaccgtcgcc
gccgctcccgtggtcccagcggtttctacttcatctgccgctggggtcgctcccaaccca
gccggcagtggcagtaacaattcaccgtcgtcctcttcttccccgacttcttcctcatct
tcctctccatcctcccctggatcgagcttggcggagagccccgaggcggccggagttagc
agcacagcaccactggggcctggggcagcaggacctgggacaggggtcccagcagtgagc
ggggccctacgggaactgctggaggcctgtcgcaatggggacgtgtcccgggtaaagagg
ctggtggacgcggcaaacgtaaatgcaaaggacatggccggccggaagtcttctcccctg
cacttcgctgcaggttttggaaggaaggatgttgtagaacacttactacagatgggtgct
aatgtccacgctcgtgatgatggaggtctcatcccgcttcataatgcctgttcttttggc
catgctgaggttgtgagtctgttattgtgccaaggagctgatccaaatgccagggataac
tggaactatacacctctgcatgaagctgctattaaagggaagatcgatgtgtgcattgtg
ctgctgcagcacggagctgacccaaacattcggaacactgatgggaaatcagccctggac
ctggcagatccttcagcaaaagctgtccttacaggtgaatacaagaaagacgaactccta
gaagctgctaggagtggtaatgaagaaaaactaatggctttactgactcctctaaatgtg
aattgccatgcaagtgatgggcgaaagtcgactcctttacatctagcagcgggctacaac
agagttcgaatagttcagcttcttcttcagcatggtgctgatgttcatgcaaaagacaaa
ggtggacttgtgcctcttcataatgcatgttcatatggacattatgaagtcacagaactg
ctactaaagcatggagcttgtgttaatgccatggatctctggcagtttactccactgcac
gaggctgcttccaagaaccgtgtagaagtctgctctttgttacttagccatggcgctgat
cctacattagtcaactgccatggcaaaagtgctgtggatatggctccaactccggagctt
agggagagattgacttatgaatttaaaggtcattctttactacaagcagccagagaagca
gacttagctaaagttaaaaaaacactcgctctggaaatcattaatttcaaacaaccgcag
tctcatgaaacagcactgcactgtgctgtggcctctctgcatcccaaacgtaaacaagtg
acagaattgttacttagaaaaggagcaaatgttaatgaaaaaaataaagatttcatgact
cccctgcatgttgcagccgaaagagcccataatgatgtcatggaagttctgcataagcat
ggcgccaagatgaatgcactggacacccttggtcagactgctttgcatagagccgcccta
gcaggtcacctgcagacctgccgcctcctgctgagttacggctctgacccctccatcatc
tccttacaaggcttcacagcagcacagatgggcaatgaagcagtgcagcagattctgagt
gagagtacacctatacgtacttctgatgttgattatcgactcttagaggcatctaaagct
ggagacttggaaactgtgaagcaactttgcagctctcaaaatgtgaattgtagagactta
gagggccggcattccacgcccttacacttcgcagcaggctacaaccgcgtgtctgttgta
gagtacctgctacaccacggtgccgatgtccatgccaaagacaagggtggcttggtgccc
cttcataatgcctgttcatatggacactatgaggtggctgagcttttagtaaggcatggg
gcttctgtcaatgtggcggacttatggaaatttacccctctccatgaagcagcagctaaa
ggaaagtatgaaatctgcaagctccttttaaaacatggagcagatccaactaaaaagaac
agagatggaaatacacctttggatttggtaaaggaaggagacacagatattcaggactta
ctgagaggggatgctgctttgttggatgctgccaagaagggctgcctggcaagagtgcag
aagctctgtaccccagagaatatcaactgcagagacacccagggcagaaattcaacccct
ctgcacctggcagcaggctataataacctggaagtagctgaatatcttctagagcatgga
gctgatgttaatgcccaggacaagggtggtttaattcctcttcataatgcggcatcttat
gggcatgttgacatagcggctttattgataaaatacaacacgtgtgtaaatgcaacagat
aagtgggcgtttactcccctccatgaagcagcccagaaaggaaggacgcagctgtgcgcc
ctcctcctagcgcatggtgcagaccccaccatgaagaaccaggaaggccagacgcctctg
gatctggcaacagctgacgatatcagagctttgctgatagatgccatgcccccagaggcc
ttacctacctgttttaaacctcaggctactgtagtgagtgcctctctgatctcaccagca
tccaccccctcctgcctctcggctgccagcagcatagacaacctcactggccctttagca
gagttggccgtaggaggagcctccaatgcaggggatggcgccgcgggaacagaaaggaag
gaaggagaagttgctggtcttgacatgaatatcagccaatttctaaaaagccttggcctt
gaacaccttcgggatatctttgaaacagaacagattacactagatgtgttggctgatatg
ggtcatgaagagttgaaagaaataggcatcaatgcatatgggcaccgccacaaattaatc
aaaggagtagaaagactcttaggtggacaacaaggcaccaatccttatttgacttttcac
tgtgttaatcagggaacgattttgctggatcttgctccagaagataaagaatatcagtca
gtggaagaagagatgcaaagtactattcgagaacacagagatggtggtaatgctggcggc
atcttcaacagatacaatgtcattcgaattcaaaaagttgtcaacaagaagttgagggag
cggttctgccaccgacagaaggaagtgtctgaggagaatcacaaccatcacaatgagcgc
atgttgtttcatggttctcctttcattaatgccattattcataaagggtttgatgagcga
catgcatacataggaggaatgtttggggccgggatttattttgctgaaaactcctcaaaa
agcaaccaatatgtttatggaattggaggaggaacaggctgccctacacacaaggacagg
tcatgctatatatgtcacagacaaatgctcttctgtagagtgacccttgggaaatccttt
ctgcagtttagcaccatgaaaatggcccacgcgcctccagggcaccactcagtcattggt
agaccgagcgtcaatgggctggcatatgctgaatatgtcatctacagaggagaacaggca
tacccagagtatcttatcacttaccagatcatgaagccagaagccccttcccagaccgca
acagccgcagagcagaagacctag

DBGET integrated database retrieval system