KEGG   Homo sapiens (human): 866
Entry
866               CDS       T01001                                 
Symbol
SERPINA6, CBG
Name
(RefSeq) serpin family A member 6
  KO
K04525  serpin A
Organism
hsa  Homo sapiens (human)
Network
nt06019  Steroid hormone biosynthesis
  Element
N00313  Transport of cortisol
Disease
H01163  Corticosteroid-binding globulin (CBG) deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    866 (SERPINA6)
Peptidases and inhibitors [BR:hsa01002]
 Peptidase inhibitors
  Family I4: serpin family
   866 (SERPINA6)
SSDB
Motif
Pfam: Serpin
Other DBs
NCBI-GeneID: 866
NCBI-ProteinID: NP_001747
OMIM: 122500
HGNC: 1540
Ensembl: ENSG00000170099
UniProt: P08185 A0A2Z4LCH4
Structure
Position
14:complement(94304248..94323336)
AA seq 405 aa
MPLLLYTCLLWLPTSGLWTVQAMDPNAAYVNMSNHHRGLASANVDFAFSLYKHLVALSPK
KNIFISPVSISMALAMLSLGTCGHTRAQLLQGLGFNLTERSETEIHQGFQHLHQLFAKSD
TSLEMTMGNALFLDGSLELLESFSADIKHYYESEVLAMNFQDWATASRQINSYVKNKTQG
KIVDLFSGLDSPAILVLVNYIFFKGTWTQPFDLASTREENFYVDETTVVKVPMMLQSSTI
SYLHDSELPCQLVQMNYVGNGTVFFILPDKGKMNTVIAALSRDTINRWSAGLTSSQVDLY
IPKVTISGVYDLGDVLEEMGIADLFTNQANFSRITQDAQLKSSKVVHKAVLQLNEEGVDT
AGSTGVTLNLTSKPIILRFNQPFIIMIFDHFTWSSLFLARVMNPV
NT seq 1218 nt   +upstreamnt  +downstreamnt
atgccactcctcctgtacacctgtcttctctggctgcccaccagcggcctctggaccgtc
caggccatggatcctaacgctgcttatgtgaacatgagtaaccatcaccggggcctggct
tcagccaacgttgactttgccttcagcctgtataagcacctagtggccttgagtcccaaa
aagaacattttcatctcccctgtgagcatctccatggccttagctatgctgtccctgggc
acctgtggccacacacgggcccagcttctccagggcctgggtttcaacctcactgagagg
tctgagactgagatccaccagggtttccagcacctgcaccaactctttgcaaagtcagac
accagcttagaaatgaccatgggcaatgccttgtttcttgatggcagcctggagttgctg
gagtcattctcagcagacatcaagcactactatgagtcagaggtcttggctatgaatttc
caggactgggcaacagccagcagacagatcaacagctatgtcaagaataagacacagggg
aaaattgtcgacttgttttcagggctggatagcccagccatcctcgtcctggtcaactat
atcttcttcaaaggcacatggacacagccctttgacctggcaagcaccagggaggagaac
ttctatgtggacgagacaactgtggtgaaggtgcccatgatgttgcagtcgagcaccatc
agttaccttcatgactcggagctcccctgccagctggtgcagatgaactacgtgggcaat
gggactgtcttcttcatccttccggacaaggggaagatgaacacagtcatcgctgcactg
agccgggacacgattaacaggtggtccgcaggcctgaccagcagccaggtggacctgtac
attccaaaggtcaccatctctggagtctatgacctcggagatgtgctggaggaaatgggc
attgcagacttgttcaccaaccaggcaaatttctcacgcatcacccaggacgcccagctg
aagtcatcaaaggtggtccataaagctgtgctgcaactcaatgaggagggtgtggacaca
gctggctccactggggtcaccctaaacctgacgtccaagcctatcatcttgcgtttcaac
cagcccttcatcatcatgatcttcgaccacttcacctggagcagccttttcctggcgagg
gttatgaacccagtgtaa

DBGET integrated database retrieval system