KEGG   Homo sapiens (human): 8664Help
Entry
8664              CDS       T01001                                 

Gene name
EIF3D, EIF3S7, eIF3-p66, eIF3-zeta
Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit D
  KO
K03251  translation initiation factor 3 subunit D
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  RNA transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    8664 (EIF3D)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:hsa03012]
    8664 (EIF3D)
Translation factors [BR:hsa03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    8664 (EIF3D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF-3_zeta NARG2_C
Motif
Other DBs
NCBI-GeneID: 8664
NCBI-ProteinID: NP_003744
OMIM: 603915
HGNC: 3278
Ensembl: ENSG00000100353
Vega: OTTHUMG00000150599
Pharos: O15371(Tbio)
UniProt: O15371
Position
22q12.3
AA seq 548 aa AA seqDB search
MAKFMTPVIQDNPSGWGPCAVPEQFRDMPYQPFSKGDRLGKVADWTGATYQDKRYTNKYS
SQFGGGSQYAYFHEEDESSFQLVDTARTQKTAYQRNRMRFAQRNLRRDKDRRNMLQFNLQ
ILPKSAKQKERERIRLQKKFQKQFGVRQKWDQKSQKPRDSSVEVRSDWEVKEEMDFPQLM
KMRYLEVSEPQDIECCGALEYYDKAFDRITTRSEKPLRSIKRIFHTVTTTDDPVIRKLAK
TQGNVFATDAILATLMSCTRSVYSWDIVVQRVGSKLFFDKRDNSDFDLLTVSETANEPPQ
DEGNSFNSPRNLAMEATYINHNFSQQCLRMGKERYNFPNPNPFVEDDMDKNEIASVAYRY
RRWKLGDDIDLIVRCEHDGVMTGANGEVSFINIKTLNEWDSRHCNGVDWRQKLDSQRGAV
IATELKNNSYKLARWTCCALLAGSEYLKLGYVSRYHVKDSSRHVILGTQQFKPNEFASQI
NLSVENAWGILRCVIDICMKLEEGKYLILKDPNKQVIRVYSLPDGTFSSDEDEEEEEEEE
EEEEEEET
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagttcatgacacccgtgatccaggacaacccctcaggctggggtccctgtgcg
gttcccgagcagtttcgggatatgccctaccagccgttcagcaaaggagatcggctagga
aaggttgcagactggacaggagccacataccaagataagaggtacacaaataagtactcc
tctcagtttggtggtggaagtcaatatgcttatttccatgaggaggatgaaagtagcttc
cagctggtggatacagcgcgcacacagaagacggcctaccagcggaatcgaatgagattt
gcccagaggaacctccgcagagacaaagatcgtcggaacatgttgcagttcaacctgcag
atcctgcctaagagtgccaaacagaaagagagagaacgcattcgactgcagaaaaagttc
cagaaacaatttggggttaggcagaaatgggatcagaaatcacagaaaccccgagactct
tcagttgaagttcgtagtgattgggaagtgaaagaggaaatggattttcctcagttgatg
aagatgcgctacttggaagtatcagagccacaggacattgagtgttgtggggccctagaa
tactacgacaaagcctttgaccgcatcaccacgaggagtgagaagccactgcggagcatc
aagcgcatcttccacactgtcaccaccacagacgaccctgtcatccgcaagctggcaaaa
actcaggggaatgtgtttgccactgatgccatcctggccacgctgatgagctgtacccgc
tcagtgtattcctgggatattgtcgtccagagagttgggtccaaactcttctttgacaag
agagacaactctgactttgacctcctgacagtgagtgagactgccaatgagccccctcaa
gatgaaggtaattccttcaattcaccccgcaacctggccatggaggcaacctacatcaac
cacaatttctcccagcagtgcttgagaatggggaaggaaagatacaacttccccaaccca
aacccgtttgtggaggacgacatggataagaatgaaatcgcctctgttgcgtaccgttac
cgcaggtggaagcttggagatgatattgaccttattgtccgttgtgagcacgatggcgtc
atgactggagccaacggggaagtgtccttcatcaacatcaagacactcaatgagtgggat
tccaggcactgtaatggcgttgactggcgtcagaagctggactctcagcgaggggctgtc
attgccacggagctgaagaacaacagctacaagttggcccggtggacctgctgtgctttg
ctggctggatctgagtacctcaagcttggttatgtgtctcggtaccacgtgaaagactcc
tcacgccacgtcatcctaggcacccagcagttcaagcctaatgagtttgccagccagatc
aacctgagcgtggagaatgcctggggcattttacgctgcgtcattgacatctgcatgaag
ctggaggagggcaaatacctcatcctcaaggaccccaacaagcaggtcatccgtgtctac
agcctccctgatggcaccttcagctctgatgaagatgaggaggaagaggaggaggaagaa
gaggaagaagaagaggaagaaacttaa

DBGET integrated database retrieval system